KEGG   Ovis aries (sheep): 101105877
Entry
101105877         CDS       T03117                                 

Gene name
DNA2
Definition
(RefSeq) DNA replication ATP-dependent helicase/nuclease DNA2 isoform X1
  KO
K10742  DNA replication ATP-dependent helicase Dna2 [EC:3.6.4.12]
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101105877 (DNA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101105877 (DNA2)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     101105877 (DNA2)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    101105877 (DNA2)
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     101105877 (DNA2)
SSDB
Motif
Pfam: Dna2 AAA_12 AAA_11 AAA_30 AAA_19 PDDEXK_1 Cas_Cas4 SRP54 Helicase_RecD PhoH UvrD-helicase CbiA UvrD_C_2 AAA_25 cobW AAA_7 AAA_23 AAA_16 ResIII
Other DBs
NCBI-GeneID: 101105877
NCBI-ProteinID: XP_004021466
Ensembl: ENSOARG00000005076
UniProt: A0A6P3ERA2 W5P4U8
LinkDB
Position
25
AA seq 1062 aa
MERVDELELLMEKSFWQEAEPPAELFQKKKVEASFSKIVLSRGMDNRYLVLAVNIVQSEE
GNDEKHLIITASQSLEDKELCILRNDWCSVQVEPGDIIHLEGDCISDTWIIDEDFGYLIL
YPDMLISGTSIASSIRCMRRAVLSETFRSSDPATRQMLIGTLLHEVFQKAISDSFAPEKL
QELASQTIQEIRHLKEMYRLKLNQDEIKQEVEEYLPSFSKWAGDFMHKHTSTDFPQMQLS
LPSDGSNSNSTCNIEVINSLDIEESIWSPRFGLKGKIDVTVGVKIHRGCKTKYKIMPLEL
KTGKESNSIEHRSQLVLYTLLSQERRADPEAGLLLYLKTGQMYPVPAKHLDKRELLRLRN
QMAFSLFHRINKSTGEEKTKLAPLPQIIEEQQTCKYCSQMGNCALYSRAVEQQMEDSSVP
TSMWPKIKEETQHLKLTHLEYFSLWCLMLTLESQSKDNKRNYQHVWLMPASEMEESGSCI
GSLIRTEHVKTVCDGQYLHNFQRKSGAIPITNLMAGDRIILSGEERTLFALSRGYVKEIN
STTVTCSLDRNLSGLPESTLFRLDQEEKNCDIDTPLGNLSKLMENTHASQKLRDLIIDFR
EPQFISYLSSVLPHDAKDTVACILKGLNKPQRQAMKKVLLSKDYTLIVGMPGTGKTTTIC
TLVRILYACGFSVLLTSYTHSAVDNILLKLAKFKIGFLRLGQIQKVHPDIQKFTEEEICR
SKSIKSLALLEELYNSQLIVATTCMGINHPIFSRKTFDFCIVDEASQISQPVCLGPLFFS
RRFVLVGDHQQLPPLVLNREARALGMSESLFKRLEQNKNAVVQLTVQYRMNSKIMSLSNK
LTYEGKLECGSDKVANAVINLPNFKDVKLELEFYADYSENPWLVGAFEPNNPVCFLNTHK
VPAPEQVEKGGVSNIMEAKLVVFLTSVFIKAGCKPSDIGIIAPYRQQLKVINDLLAHSSV
GMVEVNTVDRYQGRDKSIIIVSFVRSNEDGTLGELLKDWRRLNVAITRAKHKLILLGCVP
SLSRYPPLGKLLNHLNSEKLIIDLPSGEHESLCHLLSDFQRK
NT seq 3189 nt   +upstreamnt  +downstreamnt
atggagcgagtggacgaactggagctgctaatggagaagagtttctggcaggaggctgag
ccgccggcggagctatttcagaagaagaaggtggaagcttccttttctaagatagttctg
agccgaggaatggataaccggtacctggtattagcagtcaatattgtacagagtgaagaa
ggaaacgatgaaaagcacctaatcatcactgcttcccagtcgctagaagataaagaactg
tgtatccttaggaatgactggtgctctgtacaagtagaaccaggggacatcattcatttg
gagggagactgcatatccgatacttggataatagatgaagattttggatatttgattcta
tatcccgacatgctgatttctggcacaagcatagccagtagtattcgatgcatgagaaga
gctgtcctgagtgaaacattcaggagctctgatccagccacacgccaaatgctgattggt
acacttcttcatgaagtatttcaaaaagcaataagtgatagttttgccccagaaaagcta
caagaacttgcttctcaaactattcaagaaataaggcatctgaaggaaatgtaccgccta
aaattgaatcaagatgaaataaaacaagaggtagaggagtatcttccttcattttctaaa
tgggctggagatttcatgcataaacatacttcaactgacttccctcagatgcagctctct
ctgccaagtgatggtagtaatagtaattcaacatgtaatattgaagtgataaactcgctg
gatattgaagaaagcatttggtcccctaggtttggattgaagggcaaaatagatgttaca
gttggtgtgaaaatacatcggggatgtaaaacgaaatataagataatgccgttggaactt
aaaactggcaaagaatcaaattctattgaacaccgtagtcagcttgttctgtatacactg
ctaagccaagagaggagggctgaccccgaggccggcctgctcctctacctaaagactggc
cagatgtaccctgtgcctgccaaacatcttgataaaagagaattattaaggctaagaaat
cagatggcattctctttgtttcaccgtattaacaaatctactggagaggaaaagacaaag
cttgctcctttgccacaaataattgaggaacagcaaacctgtaaatactgttcacagatg
ggcaactgtgctctctatagcagggcggttgaacaacagatggaagacagttcagtcccc
accagcatgtggcccaaaataaaagaagaaacccagcatctcaagcttacacacttagag
tattttagcctttggtgtctaatgttaaccctggagtctcaatcaaaggataataaaaga
aactaccaacatgtatggttaatgcctgcttcagaaatggaggagagtggcagctgcatt
gggagcctgattagaacagaacatgtaaagacagtttgtgatggacagtatttacataat
ttccagcgtaaaagtggagccatacctatcacaaatctaatggcaggtgacagaattatt
ttaagtggagaagagagaacattgtttgccttgtctaggggatacgtgaaggagattaac
tcaacaacagtaacctgttcgttagacaggaacttgtcaggactcccagagtcaactttg
ttcagattggaccaggaagaaaaaaattgtgatatagataccccattaggaaatctttct
aaactgatggaaaatactcatgccagccaaaaacttcgagatttaatcattgactttcgt
gaaccacagtttatatcctacctcagttctgttcttccacatgatgcaaaggacacagtt
gcctgcattctgaaaggtttgaataagcctcagaggcaagccatgaaaaaggtacttctt
tcaaaagactacaccctcatcgtgggtatgccgggaacagggaaaacaactacaatatgt
actctcgtaagaattctctatgcctgtggttttagtgttttgttgaccagctatacacac
tctgctgttgacaatattcttttgaagttagcaaagtttaaaattggatttttgcgcttg
ggccagattcagaaggtacatccagatatccaaaaatttacagaggaggaaatttgcaga
tcaaagtccattaaatctttagctcttttagaagaactctacaatagtcaacttatagtt
gcaacaacatgtatgggaataaaccatcccatattttctcgtaaaacttttgatttttgt
atagtggatgaagcctctcaaattagccagcctgtttgcctagggccactttttttttca
cggagatttgtgttggtgggggaccatcagcagcttcctcccctggtgctaaaccgtgaa
gcaagagctcttggcatgagtgaaagcttattcaagaggctggagcagaataagaatgca
gttgtacagttaactgtgcaatacagaatgaacagtaaaattatgtccttaagtaataaa
ctgacatacgaaggaaagctggagtgtggatcagataaagtggccaacgcagtgataaac
ctacctaactttaaagatgtaaagctggaactggagttttatgctgattattcagaaaat
ccttggctggttggagcattcgagccaaacaatcctgtctgttttcttaatacacacaag
gttccagcaccagaacaagttgaaaagggaggtgtcagtaatataatggaagccaaactc
gttgttttcctgacctcagtttttattaaggctggttgtaaaccctctgatattggtatc
attgcaccatacaggcagcagttaaaggtcatcaacgacttattggcacattcttccgtt
gggatggttgaagttaatacagttgacaggtaccaaggaagagacaaaagtatcattata
gtatcttttgttagaagcaatgaagatggaactcttggtgaactgttgaaagattggcga
cgtcttaacgttgctataaccagagccaaacataagctgattctcctgggatgcgtgccc
tcactaagccgctatcctcccttggggaagctacttaatcatctaaactcagaaaaattg
atcattgatcttccatcaggagaacatgaaagcctttgtcatctattgagtgattttcaa
agaaaataa

DBGET integrated database retrieval system