KEGG   Ovis aries (sheep): 101106012
Entry
101106012         CDS       T03117                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04072  Phospholipase D signaling pathway
oas04144  Endocytosis
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04630  JAK-STAT signaling pathway
oas04810  Regulation of actin cytoskeleton
oas05163  Human cytomegalovirus infection
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101106012 (PDGFRA)
   04014 Ras signaling pathway
    101106012 (PDGFRA)
   04015 Rap1 signaling pathway
    101106012 (PDGFRA)
   04630 JAK-STAT signaling pathway
    101106012 (PDGFRA)
   04020 Calcium signaling pathway
    101106012 (PDGFRA)
   04072 Phospholipase D signaling pathway
    101106012 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    101106012 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101106012 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101106012 (PDGFRA)
   04540 Gap junction
    101106012 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101106012 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101106012 (PDGFRA)
   05206 MicroRNAs in cancer
    101106012 (PDGFRA)
   05230 Central carbon metabolism in cancer
    101106012 (PDGFRA)
   05231 Choline metabolism in cancer
    101106012 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    101106012 (PDGFRA)
   05218 Melanoma
    101106012 (PDGFRA)
   05215 Prostate cancer
    101106012 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101106012 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101106012 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101106012 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oas04090]
    101106012 (PDGFRA)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101106012 (PDGFRA)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101106012 (PDGFRA)
CD molecules [BR:oas04090]
 Proteins
  101106012 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set C2-set_2 LAT Kinase-like
Other DBs
NCBI-GeneID: 101106012
NCBI-ProteinID: XP_004009879
Ensembl: ENSOARG00000019070
UniProt: W5QCN4
LinkDB
Position
6
AA seq 1089 aa
MGTSHWALLVLGCLFTGPSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEEYPDVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQMDENEIEGRHIYIY
VPDPDVAFVPLGMTDSLVIVEDEDSVIIPCRTTDPETPVTLLSSEGVVHASYDSRQGFKG
TFSVGLYICEATVRGKKFQTIPFNVYAYTATSKLDLEMESPKTVYKAGESIVVTCTVFNN
EVVDFQWTYPGQMKGKGITRLEETKFPSIKLVYTLRVPEATVKDSGDYQCAAHQATKEVK
KMRNVTISVHEKGFIEIKPNFNLLEAVNLHEVKHFVVDVQAYPPPKITWLKDNLTLIENL
TEITTDIEKIQEISYRSKLKLIRAKEEDSGHYTVVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWTVLANNVSNIITEVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNAEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcttcacagggccgagccta
atcctctgccagctttcattaccctccatcctgcccaatgaaaatgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagtaccccgacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacggtgctggaagtggtcagcgcctcggcagcccacactgggctgtacacttgc
tattacaaccacacgcagatggacgagaacgagatcgagggcagacatatttacatctat
gtgccagacccagatgtagccttcgtacctctaggaatgacagattccttggtcatcgtg
gaggacgaagattcagtcatcatcccatgccgcacaactgatcctgagactccggtgacc
ttactcagcagtgagggggtagtgcatgcctcctatgacagcagacaaggctttaaagga
accttcagtgtcgggctctatatctgtgaggccacagtcagagggaagaagttccagacc
attccattcaatgtttatgcttacacagcaacatcaaaacttgatctggaaatggaatct
cctaagactgtatataaggcaggcgaatcgattgtggtcacctgcaccgtctttaacaac
gaggtggttgactttcaatggacttaccctggacaaatgaaaggcaaaggcatcacgagg
ctggaggaaaccaagttcccgtccatcaagttggtgtacactctgagggttcccgaggcc
acagtgaaagacagtggagattaccaatgtgctgcccaccaggccaccaaggaggtcaaa
aagatgaggaacgtcaccatttctgttcacgagaaaggatttattgaaatcaaacccaac
tttaacctgttggaagctgtcaacctgcatgaagtcaagcattttgtggtggatgtgcag
gcctatccccctcccaagataacctggctaaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagagaagattcaggaaataagttatcgaagcaaattaaag
ctgatccgagcaaaggaagaagacagtggccattatactgttgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactcttgactcaagttccgtcctccatactggacttg
gttgacgaccaccatggctctaatgggggccagactgtgagatgcacagccgaagggacc
cctcttcctgatatcgagtggatggtttgcaaggatattaagaaatgtaacaacgaaact
tcatggacggttttggccaacaacgtttcaaacatcatcacagaggtccacccccgagac
aggagcacagtggaaggccaggtgacatttgccaaagtggaggagaccattgcagtccgg
tgtctggccaagaacctcctcggggtggaaagccgagagctgaagctggtggctcccact
ctgcgctctgagctcactgtggcagctgcagtcctggtgttgttggtgattgtaatcatc
tcgctcattgtcctggtcgtcatttggaaacagaaaccaaggtatgaaatccgttggagg
gtcattgaatcaatcagccctgatggacatgaatacatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctgggg
tctggtgcttttgggaaagtggttgaaggaactgcctatggattaagtcggtctcaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgagctgaagataatgacccacctggggccgcatttaaacatcgtgaacttg
ctgggtgcctgcaccaagtcaggccccatttacattatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagagacagcttcctgagccaccatccagagaag
ccaaagaaagagctggacatttttggattgaacccggctgacgaaagcacaagaagttat
gttatcttatcttttgaaaacaatggtgactacatggacatgaagcaagctgacactaca
cagtatgtccccatgctggagagaaaagaggtttctaaatactcggacatccagagagcg
ctgtatgatcgcccagcctcgtataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcagatgataacgcagaaggcctgactttgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacctggcg
gctcgcaacgtcctcctggcgcaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgactcgaactatgtgtccaaaggcagtacctttctccctgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacgctgagtgacgtctggtcc
tatggcatcctgctctgggaaatcttttcccttggtggcacaccctaccctggcatgatg
gtggattctacattctacaataagatcaagagtggataccggatggccaagcctgaccat
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agctatgaaaagatccacctggactttctgaagagtgaccaccccgctgtggcacgcatg
cgcgtggactccgacaacgcctacattggcgtcacctacaaaaatgaagaagacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagtgcagatagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaggacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctaccttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggatctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system