KEGG   Ovis aries (sheep): 101106012
Entry
101106012         CDS       T03117                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04072  Phospholipase D signaling pathway
oas04144  Endocytosis
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04630  JAK-STAT signaling pathway
oas04810  Regulation of actin cytoskeleton
oas05163  Human cytomegalovirus infection
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101106012 (PDGFRA)
   04014 Ras signaling pathway
    101106012 (PDGFRA)
   04015 Rap1 signaling pathway
    101106012 (PDGFRA)
   04630 JAK-STAT signaling pathway
    101106012 (PDGFRA)
   04020 Calcium signaling pathway
    101106012 (PDGFRA)
   04072 Phospholipase D signaling pathway
    101106012 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    101106012 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101106012 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101106012 (PDGFRA)
   04540 Gap junction
    101106012 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101106012 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101106012 (PDGFRA)
   05206 MicroRNAs in cancer
    101106012 (PDGFRA)
   05230 Central carbon metabolism in cancer
    101106012 (PDGFRA)
   05231 Choline metabolism in cancer
    101106012 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    101106012 (PDGFRA)
   05218 Melanoma
    101106012 (PDGFRA)
   05215 Prostate cancer
    101106012 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101106012 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101106012 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101106012 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oas04090]
    101106012 (PDGFRA)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101106012 (PDGFRA)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101106012 (PDGFRA)
CD molecules [BR:oas04090]
 Proteins
  101106012 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set C2-set_2 LAT Kinase-like
Other DBs
NCBI-GeneID: 101106012
NCBI-ProteinID: XP_004009879
Ensembl: ENSOARG00000019070
UniProt: A0A6P3EAE5 W5QCN4
LinkDB
Position
6
AA seq 1089 aa
MGTSHWALLVLGCLFTGPSLILCQLSLPSILPNENERVVQLNSSFSLRCFGESEVSWQYP
MSEEEYPDVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQMDENEIEGRHIYIY
VPDPDVAFVPLGMTDSLVIVEDEDSVIIPCRTTDPETPVTLLSSEGVVHASYDSRQGFKG
TFSVGLYICEATVRGKKFQTIPFNVYAYTATSKLDLEMESPKTVYKAGESIVVTCTVFNN
EVVDFQWTYPGQMKGKGITRLEETKFPSIKLVYTLRVPEATVKDSGDYQCAAHQATKEVK
KMRNVTISVHEKGFIEIKPNFNLLEAVNLHEVKHFVVDVQAYPPPKITWLKDNLTLIENL
TEITTDIEKIQEISYRSKLKLIRAKEEDSGHYTVVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMVCKDIKKCNNETSWTVLANNVSNIITEVHPRD
RSTVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNAEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcactcctggtcttaggctgtctcttcacagggccgagccta
atcctctgccagctttcattaccctccatcctgcccaatgaaaatgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagtaccccgacgtggaaatcagaaacgaggagaacaacagtggcctt
tttgtgacggtgctggaagtggtcagcgcctcggcagcccacactgggctgtacacttgc
tattacaaccacacgcagatggacgagaacgagatcgagggcagacatatttacatctat
gtgccagacccagatgtagccttcgtacctctaggaatgacagattccttggtcatcgtg
gaggacgaagattcagtcatcatcccatgccgcacaactgatcctgagactccggtgacc
ttactcagcagtgagggggtagtgcatgcctcctatgacagcagacaaggctttaaagga
accttcagtgtcgggctctatatctgtgaggccacagtcagagggaagaagttccagacc
attccattcaatgtttatgcttacacagcaacatcaaaacttgatctggaaatggaatct
cctaagactgtatataaggcaggcgaatcgattgtggtcacctgcaccgtctttaacaac
gaggtggttgactttcaatggacttaccctggacaaatgaaaggcaaaggcatcacgagg
ctggaggaaaccaagttcccgtccatcaagttggtgtacactctgagggttcccgaggcc
acagtgaaagacagtggagattaccaatgtgctgcccaccaggccaccaaggaggtcaaa
aagatgaggaacgtcaccatttctgttcacgagaaaggatttattgaaatcaaacccaac
tttaacctgttggaagctgtcaacctgcatgaagtcaagcattttgtggtggatgtgcag
gcctatccccctcccaagataacctggctaaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagagaagattcaggaaataagttatcgaagcaaattaaag
ctgatccgagcaaaggaagaagacagtggccattatactgttgtagttcaaaatgaagat
gatgtgaagagctatacttttgaactcttgactcaagttccgtcctccatactggacttg
gttgacgaccaccatggctctaatgggggccagactgtgagatgcacagccgaagggacc
cctcttcctgatatcgagtggatggtttgcaaggatattaagaaatgtaacaacgaaact
tcatggacggttttggccaacaacgtttcaaacatcatcacagaggtccacccccgagac
aggagcacagtggaaggccaggtgacatttgccaaagtggaggagaccattgcagtccgg
tgtctggccaagaacctcctcggggtggaaagccgagagctgaagctggtggctcccact
ctgcgctctgagctcactgtggcagctgcagtcctggtgttgttggtgattgtaatcatc
tcgctcattgtcctggtcgtcatttggaaacagaaaccaaggtatgaaatccgttggagg
gtcattgaatcaatcagccctgatggacatgaatacatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggactcgtgcttggtcggatcctgggg
tctggtgcttttgggaaagtggttgaaggaactgcctatggattaagtcggtctcaacct
gtcatgaaagtagcagtgaagatgctaaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgagctgaagataatgacccacctggggccgcatttaaacatcgtgaacttg
ctgggtgcctgcaccaagtcaggccccatttacattatcactgagtactgcttctatggg
gatttggtcaactatttgcataagaatagagacagcttcctgagccaccatccagagaag
ccaaagaaagagctggacatttttggattgaacccggctgacgaaagcacaagaagttat
gttatcttatcttttgaaaacaatggtgactacatggacatgaagcaagctgacactaca
cagtatgtccccatgctggagagaaaagaggtttctaaatactcggacatccagagagcg
ctgtatgatcgcccagcctcgtataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcagatgataacgcagaaggcctgactttgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccatcgggacctggcg
gctcgcaacgtcctcctggcgcaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgactcgaactatgtgtccaaaggcagtacctttctccctgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacgctgagtgacgtctggtcc
tatggcatcctgctctgggaaatcttttcccttggtggcacaccctaccctggcatgatg
gtggattctacattctacaataagatcaagagtggataccggatggccaagcctgaccat
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agctatgaaaagatccacctggactttctgaagagtgaccaccccgctgtggcacgcatg
cgcgtggactccgacaacgcctacattggcgtcacctacaaaaatgaagaagacaagctg
aaggactgggagggtggcctcgacgagcagaggctgagtgcagatagcggctacatcatc
cctctgcccgacatcgaccctgttcctgaggaggaggacctgggcaagaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctaccttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggatctggtggaggacagcttcctgtaa

KEGG   Ovis aries (sheep): 101108266
Entry
101108266         CDS       T03117                                 

Gene name
INSRR
Definition
(RefSeq) insulin receptor-related protein
  KO
K05086  insulin receptor-related receptor [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas04810  Regulation of actin cytoskeleton
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101108266 (INSRR)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    101108266 (INSRR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101108266 (INSRR)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101108266 (INSRR)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   101108266 (INSRR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like B2
Other DBs
NCBI-GeneID: 101108266
NCBI-ProteinID: XP_027832360
Ensembl: ENSOARG00000006431
UniProt: A0A6P7EM19
LinkDB
Position
1
AA seq 1301 aa
MAVPSLWPWVACLLAVLLSLGFGLDTREVCPSLDIRSEVAELRRLENCSVVEGHLQILLM
FTATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLAVIRGARLFLGYALVIFEM
PHMRDVGLPALGAVLRGAVRVEKNQELCHLSTIDWGLLQPSPGANHIVGNKLGEECADVC
PGLLGATGEPCARTTFSGHTDYRCWTSSHCQKVCPCPRGLACTVRGECCHTECLGGCSRP
EDPRACVACRHLYFQGACHRACPPGTYQHESWRCVTAERCASLRSVPGRASTFGIHQGSC
LAQCPPGFTRNDSSIFCHKCEGLCPKECKVGTKTIDSVQAAQDLVGCTHVEGSLILNLRQ
GYNLELELQRSLGLVETITGFLKIKHSFALVSLGFFKNLKLIRGDTMVDGNYTLYVLDNQ
NLQQLGSWVAAGLTIPVGKIYFAFNPRLCLEHIYRLEEVTGTKGRQNKAEINPRTNGDRA
ACQTRTLRFVSNVTEANRILLRWERYEPLEARDLLSFIVYYKESPFQNATEYVGPDACGA
QSWNLLDVELPLSRTQEPGVTLAPLKPWTQYAVFVRAITLTTAEDSPHQGAQSPIVYLRT
LPAAPTVPQDVISTSNSSSHLLVRWKPPIQRNGNITYYLVLWQRLAEDSDLYLNDYCHRG
LRLPTSNNDPRFDGEDGELEADREPGCCPCQHPPPGQVLPPLEAQEASFQKKFENFLHNA
ITIPKSPWKVTSINKSPQRDSGRSRRAAEALRLGGNSSDFKIQEDKVPRERAVLSGLRHF
TEYRIDIHACNHAAHTVGCSAATFVFARTMPHREADGIPGKVAWEAASKSSVLLRWLEPP
DPNGLILKYEIKYRRLGEEATVLCVSRLRYAKFGGVHLALLPPGNYSARVRATSLAGNGS
WTDSVAFYIPGPEEEDSGGLHVLLTVTPVGLMLLIILAALGFFYSKKRNSTLYASVNPEY
FSASHMYIPDEWEVPREQISIIRELGQGSFGMVYEGLAQGLEVGEEPTPVALKTVNELAS
PRERIEFLKEASVMKAFKCHHVVRLLGVVSQGQPTLVIMELMARGDLKSHLRSLRPEAEN
NPGLPRPALGDMIQMAGEIADGMAYLAANKFVHRDLAARNCMVSQDFTVKIGDFGMTRDV
YETDYYRKGGKGLLPVRWMAPESLKDGIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQ
VLKFVMDGGVLEELESCPVQLQELMQRCWQQNPRLRPTFTHILDSIQEELRPSFRLLSFY
HSPGCRGARASLPPTDAEPDSPRTPKEASSDFSPQNGGPGH
NT seq 3906 nt   +upstreamnt  +downstreamnt
atggcagtgcccagtctgtggccatgggtagcctgcctgcttgcagtcctcctctccttg
ggatttggcctggacacgagagaggtgtgccccagcctggacatccgctcagaggtggca
gagctgcggcggctggagaactgcagcgtagtggagggccacctgcagatcctgctcatg
ttcacagccactggcgaggacttccgtggcctcagcttcccacgcctcacccaggtcacc
gactacctgctgctcttccgggtctatggcctggagagcctgcgtgacctcttccccaac
ctggcggtcatccgcggtgcccgcctcttcctgggctacgcactggtcatcttcgagatg
ccacacatgcgggatgtggggctgccggcgctgggggccgtgctgcgtggggctgtgcgt
gtggagaagaaccaggagctctgccatctctccaccattgactggggtctgctgcagcct
tcacctggtgccaaccacattgtgggcaacaagctgggcgaggagtgtgccgatgtgtgc
cccggcctgcttggcgccaccggtgagccctgtgccaggactacattcagcggtcacacc
gactacaggtgctggacctccagtcactgccagaaagtgtgcccctgtcctcgtgggctg
gcctgcacagtcaggggcgagtgctgccacaccgagtgcctgggaggctgcagccggcca
gaagacccccgagcctgtgtcgcctgccgccacctctacttccagggcgcctgccaccgg
gcctgcccgccaggcacctaccagcatgagtcctggcgctgcgtcacagcggagcgctgt
gccagcctgcgctctgtgcctggccgtgcctccaccttcggcatccaccagggtagttgt
ctggcccagtgccctccaggcttcacccgtaatgatagcagcatattctgccacaaatgc
gaggggctgtgccccaaagagtgcaaagtgggcaccaagaccatcgactctgtccaggca
gcacaggatctggtgggctgcacccacgtggaagggagcctcatcctcaacctccgccaa
ggctataacctggagctggagctgcagcgaagcctgggactggtagagaccatcactggc
ttcctcaaaatcaagcactcctttgccctcgtgtccctaggctttttcaagaacctcaaa
cttatccggggggacaccatggtggatgggaactacaccttgtacgtgctggataaccag
aacctacagcagctggggtcctgggtggctgcagggctcaccattcctgtgggcaagata
tacttcgccttcaacccacgcctctgcttggagcacatctaccgcttggaggaggtgact
ggcactaagggacggcaaaacaaggctgagatcaacccccgcaccaacggagaccgcgct
gcctgccagactcgcactctgcgctttgtgtccaacgtgacggaggccaatcgcatcttg
ctgcgatgggagcgctacgaacctcttgaggctcgcgacctactcagcttcatcgtgtac
tacaaggagtccccattccagaatgccacagagtacgtaggtccagatgcctgtggggcc
cagagctggaacctgctggatgtggagctgcccctcagccgcacccaggagccgggggtg
accctagccccgctcaagccctggacacagtatgctgtgtttgtacgggccatcacactg
accacagcggaggacagcccccatcaaggagcccaaagccccatcgtctacctccgaacc
ttaccggcagcgcccacagtgccccaggacgtcatctccacgtccaattcctcctcccac
ctactggtgcgctggaagccaccgatccagcgcaacggaaacatcacctactacctggtg
ctgtggcaacgtctggcagaggacagcgacctctacctcaatgactactgccaccgcggc
ttgcggctgcccaccagcaacaacgatcctcgcttcgacggagaagacggggaactcgag
gccgacagggagcctggctgctgcccttgccagcacccacctcctgggcaggtcctacca
ccgctggaggcacaggaggcgtcgttccagaagaagtttgaaaactttctacacaacgcc
atcaccattcccaaatccccttggaaggtgacatccatcaataagagccctcaaagggac
tcagggaggagccgacgggcagccgaggccctccggcttgggggaaacagctcggatttc
aagattcaagaggacaaagtgcctcgggagcgagcggtgctgagtggcctgcgccacttc
acagagtaccggatcgacatccatgcctgcaaccacgcggcgcacaccgtgggctgcagc
gcggccaccttcgtctttgcgcgcaccatgccccacagagaagctgatggtatcccagga
aaagtggcttgggaggcagccagcaagagcagtgttctcctgcgctggcttgagccaccg
gaccccaacggactcattctcaagtacgaaatcaagtaccgccgcctgggagaggaggcc
acagtgctgtgtgtgtcccgcctgcgatatgccaaatttgggggtgtccacctggccctg
ctgcctcctggaaactactctgccagagttcgggcaacctcactggctggcaacggctcc
tggacagacagtgtcgctttctacatccctggcccggaggaggaagactccggggggctg
cacgtccttctcaccgtcacccctgtggggctcatgctgcttatcattcttgctgccctt
ggtttcttctacagcaagaagagaaacagtaccctgtatgcctctgtgaatccggaatac
ttcagcgcctctcacatgtacatccccgatgagtgggaggtgcctcgggagcagatctcc
ataatccgagaactgggccagggctctttcgggatggtatacgaggggctggcacaagga
ctggaggttggagaggagcccacgccggtggccctgaagaccgtgaatgagctggccagc
ccacgagaacgcattgagttcctcaaggaagcctctgtcatgaaggcattcaagtgccac
catgtggtgcgtctcctgggcgtggtgtctcagggccagccaaccctggtcatcatggag
ttaatggcccgaggggacctcaagagccatcttcgatctctgcggcccgaggcagagaac
aaccctgggctcccacggccagcactgggagatatgatccagatggctggtgagattgcg
gatggcatggcctaccttgctgccaacaagtttgtgcatcgagacctcgcggcccggaac
tgcatggtgtcccaggacttcactgtcaagattggggacttcgggatgactcgagatgtg
tatgagacagactactaccgcaagggcgggaaggggctgctgcctgtccgctggatggcc
cccgagtccctcaaagatggaatcttcaccacccactctgacgtctggtccttcggtgtg
gtgctgtgggagatcgtgaccctggctgaacaaccttaccagggcctatccaatgagcag
gtgctcaagttcgtcatggacggtggagtcctggaagagctggagagctgtcccgttcag
ctgcaggagctgatgcagcgctgctggcagcagaacccgcgcctgcgccccacctttacc
cacatcctggacagcatacaggaggagctgaggccctccttccgcctcctctccttctat
cacagcccaggatgccggggggcccgggcctccctgccgcccaccgatgcagagcctgac
tccccccgaaccccaaaagaggcctcttcagacttcagcccccagaatgggggtccagga
cattga

KEGG   Ovis aries (sheep): 101122783
Entry
101122783         CDS       T03117                                 

Gene name
PDGFRB
Definition
(RefSeq) LOW QUALITY PROTEIN: platelet-derived growth factor receptor beta
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04072  Phospholipase D signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04630  JAK-STAT signaling pathway
oas04810  Regulation of actin cytoskeleton
oas05165  Human papillomavirus infection
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101122783 (PDGFRB)
   04014 Ras signaling pathway
    101122783 (PDGFRB)
   04015 Rap1 signaling pathway
    101122783 (PDGFRB)
   04630 JAK-STAT signaling pathway
    101122783 (PDGFRB)
   04020 Calcium signaling pathway
    101122783 (PDGFRB)
   04072 Phospholipase D signaling pathway
    101122783 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    101122783 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101122783 (PDGFRB)
   04540 Gap junction
    101122783 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101122783 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101122783 (PDGFRB)
   05206 MicroRNAs in cancer
    101122783 (PDGFRB)
   05230 Central carbon metabolism in cancer
    101122783 (PDGFRB)
   05231 Choline metabolism in cancer
    101122783 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    101122783 (PDGFRB)
   05218 Melanoma
    101122783 (PDGFRB)
   05215 Prostate cancer
    101122783 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101122783 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101122783 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101122783 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oas04090]
    101122783 (PDGFRB)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101122783 (PDGFRB)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101122783 (PDGFRB)
CD molecules [BR:oas04090]
 Proteins
  101122783 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 ig I-set Ig_2 V-set Ig_6
Other DBs
NCBI-GeneID: 101122783
NCBI-ProteinID: XP_027826200
Ensembl: ENSOARG00000006538
UniProt: A0A6P7E516
LinkDB
Position
5
AA seq 1106 aa
MDTMRLPSALRAAVLKGQVLLLLLLFLLGPRASXGLVIIPPGPELVLNLSSTFVLTCSGP
APVVWERMSQKPPQEMTETQDGTFSSVLTLVNVTGLDTGEYFCGYKGSHGLEASERKRLY
IFVPDPSVGFLPVDPEELFIFLTEITETTIPCRVTDPRLVVMLHEKKVDVPLPIAYDPQR
GFSGTFEDKTYICKTTIGDREVDSDAYHVYSLQVSSINVSVNAVQTVVRQGENITIMCIV
TGNEVVNFEWTYPRMESGRLVEPVTDFLFEMPHIRSILHIPSAELGDSGTYICNVSESVS
DHRDEKAINVTVVENGYVRLLGELDPVQFAELHRSRTLQVVFEAYPPPTVMWFKDNRTLG
DSSAGEIVLSTRNVSETRYVSELTLVRVKVAEAGYYTMRAFHEDAEAQLSFQLQVNVPVR
VLELSESHPANGEQTVRCRGRGMPQPHLTWSTCSDLKRCPRELPPTPLGNSSEEESQLET
NVTYWAEEQEFEVVSTLRLRHVDQPLSVRCTLHNLLGYDVQEVTVVPHSLPFKVVVISAI
LALVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRD
QLVLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHL
GPHLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQRCSDKRRPPSAELYSN
ALPVGLPLPSHVSLPGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNY
VPSAPERTCRVTLINESPVLSYTDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGK
LVKICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFT
LGGTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLL
ERLLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFSGLRSPLDTSSVLYTAVQPNEGD
NDYIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQEEPEPELQPTS
HVEPEPKWPPDSSCPGPRAEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atggataccatgcggcttccgagcgccctgcgagctgctgtcctcaaaggccaggtgcta
ttgctgctcctgctgtttctgctgggaccacgggcctccnggggcctggtcatcataccc
ccggggccagaacttgtcctcaacctctccagcacatttgttctgacctgctcgggccca
gctccagtggtgtgggaacggatgtctcagaaacccccacaggaaatgaccgagacccag
gatggcacattctccagcgtgctgacactggtcaacgtcactggactagacacaggagaa
tacttctgtggctacaaaggctcccatgggctggaggccagtgagcgaaaacggctctac
atctttgtgccagatccttctgtgggctttctccctgtcgaccccgaggagctatttatc
tttctcacggaaataactgagaccacaattccatgccgagtgacggatccgaggctggtg
gtgatgctgcacgagaagaaggtggatgtccctctgcccatagcctatgaccctcaacgt
ggcttctctggtacctttgaggacaagacctacatctgcaaaaccaccatcggggacagg
gaggtggattccgatgcctaccatgtctacagcctccaggtgtcatccatcaatgtctca
gtgaatgcagtgcagactgtggtccgccaaggggagaatatcaccatcatgtgcattgtg
accgggaatgaggtggtcaacttcgagtggacatacccacgcatggagagtgggcgcctg
gtggagccagtgactgacttcctctttgaaatgccccacatacgttctatcctgcacatc
cccagtgctgagctgggagactcagggacctacatctgcaatgtgtcagaaagtgtgagc
gaccatcgtgatgaaaaggctatcaatgtcaccgtggtcgagaacggctatgtgcggctg
ctgggagagctggaccctgtgcaattcgccgagctccaccgcagccggacactgcaggtg
gtgtttgaggcctacccgccgcccactgtcatgtggttcaaggacaaccgaaccctgggt
gactctagcgccggcgagatcgtgctgtccacgcgcaatgtgtctgagactcggtatgtg
tcagagctgacactggtgcgggtaaaggtggctgaggctggctactacaccatgcgggcc
ttccatgaggatgctgaagcccagctctccttccagctgcaggtcaatgtgcctgtccgt
gtgctggagctgagcgagagccaccctgccaatggggagcagacagttcgttgtcgcggc
cggggcatgccccagccacacctcacctggtctacctgcagtgacctcaaaaggtgtccg
cgggagctgccgcccacgccgctggggaacagttccgaggaggagagccagctagagacg
aatgtgacatactgggcggaggagcaggagttcgaggtggtgagcacactgcgcctgcgc
catgtggatcagccgctgtccgtgcgctgcacgctgcacaacctgctgggctacgacgtg
caggaggtcaccgtggtgccacactccctgcccttcaaggtggtggtgatctcagccatc
ctggccttggtggtcctcacgatcatctccctcattatcctcatcatgctctggcagaag
aagccacgctatgaaatccgatggaaagtgattgaatctgtgagctctgatggccatgag
tacatctatgtggaccctatgcagctgccctacgactccacctgggagctgccacgggac
cagcttgtgctcggacgcacgctgggctccggggcctttgggcaggtggtggaggccaca
gctcatggcctgagccattctcaggctaccatgaaagtggccgtgaagatgctgaaatcc
acagcccgcagcagtgagaagcaagccctcatgtcggagctgaagatcatgagtcacctt
gggccccacctgaacgtggtgaacctgctgggggcctgcactaaaggagggcccatctac
atcatcaccgagtactgccgttatggcgacctggtggactacctgcaccgcaacaagcac
accttcctgcagcgctgctcggacaagcgccgcccgcccagcgccgagctctacagcaac
gccctgcctgtcgggctccctttgcctagccacgtgtcactgcctggggagagcgatggt
ggctacatggacatgagcaaggacgagtcggtggactatgtgcccatgctggacatgaaa
ggagatgtcaaatacgcagacatcgagtcctccaactacatggctccttatgataactac
gtcccctctgctcctgagaggacttgccgggtgactttgatcaacgagtccccagtgctt
agctacacggatcttgtgggcttcagctaccaggtggccaatggcatggagttcctggcc
tctaagaattgcgtccaccgagacctggcagccaggaacgtgctcatctgtgagggcaag
ctggtcaagatctgcgactttggcctggctcgtgacatcatgcgggactcgaactacatc
tccaagggcagcaccttcctgcctctgaagtggatggcccctgagagcatcttcaacagc
ctctacactaccctgagtgatgtatggtccttcggcatcctgctctgggagatcttcacg
ctgggtggcaccccgtacccagagctgcccatgaacgagcagttctacaatgccatcaag
aggggctaccgcatggcccagcctgcccatgcctctgacgaaatctacgagatcatgcag
aagtgctgggaagagaagttcgagatccggccccccttctcccagctggtgctgcttctc
gagagactgctgggtgagggctacaaaaagaagtaccagcaggtggatgaggagtttctg
aggagcgaccacccagccatccttcggtcccaagcccgcttgcctggcttcagtggcctc
cgatctcctctggacaccagctccgtcctctatactgctgtgcagcccaacgagggggac
aatgactacatcatccccctgcctgaccccaaacccgaggttgctgatgagggcccactg
gagggttcccccagccttgccagctccaccctgaatgaagtcaacacctcctctaccatc
tcctgtgacagccctctggaaccccaagaggagccagagccagagctgcagcccacctcc
cacgtggagccagagcccaagtggccaccggattccagctgccccgggcctcgggccgag
gcggaggacagcttcctgtag

KEGG   Ovis aries (sheep): 443515
Entry
443515            CDS       T03117                                 

Gene name
IGF1R
Definition
(RefSeq) insulin-like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04114  Oocyte meiosis
oas04140  Autophagy - animal
oas04144  Endocytosis
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04510  Focal adhesion
oas04520  Adherens junction
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04730  Long-term depression
oas04913  Ovarian steroidogenesis
oas04914  Progesterone-mediated oocyte maturation
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05205  Proteoglycans in cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    443515 (IGF1R)
   04014 Ras signaling pathway
    443515 (IGF1R)
   04015 Rap1 signaling pathway
    443515 (IGF1R)
   04066 HIF-1 signaling pathway
    443515 (IGF1R)
   04068 FoxO signaling pathway
    443515 (IGF1R)
   04151 PI3K-Akt signaling pathway
    443515 (IGF1R)
   04152 AMPK signaling pathway
    443515 (IGF1R)
   04150 mTOR signaling pathway
    443515 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    443515 (IGF1R)
   04140 Autophagy - animal
    443515 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    443515 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    443515 (IGF1R)
   04520 Adherens junction
    443515 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    443515 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    443515 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    443515 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    443515 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    443515 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    443515 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443515 (IGF1R)
   05202 Transcriptional misregulation in cancer
    443515 (IGF1R)
   05205 Proteoglycans in cancer
    443515 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    443515 (IGF1R)
   05214 Glioma
    443515 (IGF1R)
   05218 Melanoma
    443515 (IGF1R)
   05215 Prostate cancer
    443515 (IGF1R)
   05224 Breast cancer
    443515 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    443515 (IGF1R)
   01522 Endocrine resistance
    443515 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    443515 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oas04090]
    443515 (IGF1R)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     443515 (IGF1R)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   443515 (IGF1R)
CD molecules [BR:oas04090]
 Proteins
  443515 (IGF1R)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain Pkinase Furin-like fn3 Kinase-like DUF4476 Insulin_TMD
Other DBs
NCBI-GeneID: 443515
NCBI-ProteinID: XP_027812816
Ensembl: ENSOARG00000010005
UniProt: A0A6P7D2Q9
LinkDB
Position
18
AA seq 1367 aa
MKSSSGGGSPTSLWGLLFFAAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAASNNYIVGNKPPKECGD
LCPGTMEEKPLCEKTTINNEYNYRCWTTNRCQKMCPSACGKRACTETHECCHPECLGSCS
APDNATACVACRHYYYAGICVPSCPPNTYRFEGWRCVDRDFCANIPNAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRQILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDSYLYRH
NYCSKDKIPIRKYADGTIDVEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNAIFVPRPERKRREVMQIANTTMSSRSRNTTVLDTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTEPVFFYVQAKTTYENFIHLMIALPIAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTHSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSVKDEMEAGFREVSFYYSEENKPPEPEELDLEPENMESVPLDPSASSASLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt   +upstreamnt  +downstreamnt
atgaagtctagctccggaggagggtccccgacctcgctgtggggactcctgtttttcgcc
gccgcgctctcgctctggcccacgagtggagaaatctgcgggccgggcatcgacatccgc
aacgactaccagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatttccaaggctgaggactaccgcagctaccgcttccccaagctcaccgtc
atcaccgagtacctgctgctgttccgcgtggccggcctcgagagcctgggcgacctcttc
cccaacctcacggtcatccgcggctggaagctcttctacaactacgccctggtcatcttc
gagatgaccaacctcaaggacatcgggctctacaacctgcggaatatcacccgtggggcc
atccggatcgagaagaacgccgacctctgctacctgtccacggtggactggtccctgatc
ctggacgccgcatccaacaactacattgtggggaacaagccccccaaggaatgcggggac
ctgtgcccggggacgatggaggagaagccgctgtgcgagaagacgaccatcaacaacgag
tacaactaccgctgctggaccacaaaccgctgccagaaaatgtgtcccagcgcgtgcggg
aagcgggcgtgcacggagacccacgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcccgacaacgccacggcctgcgtggcctgccgccactactactacgccggcatctgc
gtgcccagctgcccgcccaacacctaccgcttcgagggctggcgctgcgtggaccgcgac
ttctgcgccaacatccccaacgccgagagcagcgactccgagggcttcgtcatccacgac
ggcgagtgcatgcaggagtgcccgtcgggcttcatccgcaacgggagccagagcatgtac
tgcatcccttgcgaaggcccttgtcccaaagtgtgtgaggaagaaaagaagacaaagacc
attgattctgtcacttctgctcagatgctccaaggatgcaccatcttcaaaggcaatctg
ctcatcaacatccgacgtggcaataacatcgcttcggaactggagaacttcatggggctc
atcgaggtggtgacgggctacgtgaagatccgccactcccacgccttggtctccttgtcc
ttcctgaagaacctgcgccagatcctaggggaggagcagctagaggggaactactccttc
tacgtccttgacaaccagaacctgcagcagctgtgggactgggaccaccgcaacctgacc
atcaaagctgggaaaatgtacttcgcgttcaatcccaagctgtgtgtctcggagatttac
cgcatggaggaagtgacggggactaaggggcgccagagcaaaggcgacataaacaccagg
aacaacggggagagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacg
tcgaagaaccgaatcatcatcacctggcaccggtaccggccccccgactaccgggacctc
atcagcttcaccgtctactacaaggaagccccctttaaaaacgtcacggagtatgatggg
caggacgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaag
gacgtggagcctggcattttgctgcacgggctgaagccctggacgcagtacgccgtttac
gtgaaggccgtgaccctcaccatggtggagaacgaccacatccgtggggccaagagcgag
atcctgtacattcgcaccaatgcatcagttccttccatccccctggatgtcctctcggcc
tcaaactcctcttctcagctgatcgtgaagtggaacccgccctccctgcccaacggcaac
ctgagctactacatcgtgcgctggcagcgccagccccaggatagctacctgtaccggcac
aactactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgatgtc
gaggaggtgacggagaaccccaagaccgaggtgtgcggcggggagaaagggccgtgctgc
gcttgccccaaaaccgaagccgagaagcaggcggagaaggaggaggccgagtaccgcaag
gtcttcgagaacttcctgcacaacgccatcttcgtgcccagacccgaacggaagcggagg
gaggtcatgcagatcgccaacaccaccatgtccagccggagcaggaacaccacggtgctg
gacacctacaacatcacagacccggaagagctcgagactgagtaccctttcttcgagagc
agagtggacaacaaggagagaactgtcatctccaacctccggccttttactctgtaccga
atcgacatccacagctgtaaccacgaggctgagaagcttggctgcagcgcctctaacttt
gtctttgcaagaaccatgcctgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgagaactccatctttttaaaatggccagaacctgagaatcccaatgga
ttgatcctcatgtatgaaataaaatatggatcccaagtggaggatcagcgggaatgtgtg
tccagacaggagtacaggaagtatggaggagccaagctaaaccggctcaacccagggaac
tacacagcccggatccaggccacctctctctctgggaatgggtcatggacggagcctgtg
ttcttctatgttcaggccaagacgacatatgagaacttcatccacctgatgattgctctg
cccattgcggttctgttgatagtgggaggcttggttataatgctgtatgtcttccataga
aaaagaaataacagcaggctgggaaatggagtgctgtatgcctctgtgaacccggagtat
ttcagtgcagctgatgtgtacgtgcctgacgagtgggaggtggcccgggagaagatcacc
atgagccgcgagctgggccagggctccttcgggatggtctacgaaggcgtggccaagggc
gtggtcaaggatgagcccgagaccagggtggccattaagacggtgaacgaggccgccagc
atgcgcgagcggatcgagttcctcaacgaggcctcggtgatgaaggagttcaactgtcac
cacgtggtgcgcttgctgggcgtggtgtcccagggccagccgacgctggtcatcatggaa
ctgatgacccggggggacctcaagagttacctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctcccagcctaagcaaaatgatccagatggctggcgagattgca
gatggcatggcatacctcaacgccaataagtttgtccacagagacctcgctgcccggaac
tgcatggtggccgaagatttcacagtcaaaatcggagattttgggatgacaagagacatc
tatgagacggactattaccggaagggggggaaggggctgctgcccgtccgctggatgtcc
cccgagtccctcaaggatggagtcttcaccactcactctgacgtctggtccttcggggtc
gtcctctgggagatcgccacgctggccgagcagccgtaccagggcctgtccaacgagcag
gtccttcgctttgtcatggagggcggccttctggacaagccggacaactgtcctgacatg
ctgtttgagctgatgcgcatgtgctggcagtacaaccccaagatgcggccctcgttcctg
gagatcatcagcagcgtcaaggacgagatggaggcgggcttccgggaggtctccttctac
tacagcgaggagaacaagccgcccgagccggaggagctggacctggagcccgagaacatg
gagagcgtgccgctggacccctcggcctcctctgcctccctgccgctgcccgacagacac
tcaggacacaaggctgagaacggcccgggcccgggcgtgctggtcctgcgggccagcttc
gacgagcggcagccgtacgcccacatgaacgggggccgcaagaatgagcgcgccctgccg
ctgccccagtcctcgacctgctga

KEGG   Ovis aries (sheep): 443548
Entry
443548            CDS       T03117                                 

Gene name
FGFR2
Definition
(RefSeq) fibroblast growth factor receptor 2 isoform X3
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04144  Endocytosis
oas04151  PI3K-Akt signaling pathway
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04810  Regulation of actin cytoskeleton
oas05200  Pathways in cancer
oas05215  Prostate cancer
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    443548 (FGFR2)
   04014 Ras signaling pathway
    443548 (FGFR2)
   04015 Rap1 signaling pathway
    443548 (FGFR2)
   04020 Calcium signaling pathway
    443548 (FGFR2)
   04151 PI3K-Akt signaling pathway
    443548 (FGFR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    443548 (FGFR2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    443548 (FGFR2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    443548 (FGFR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443548 (FGFR2)
   05230 Central carbon metabolism in cancer
    443548 (FGFR2)
  09162 Cancer: specific types
   05226 Gastric cancer
    443548 (FGFR2)
   05215 Prostate cancer
    443548 (FGFR2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    443548 (FGFR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    443548 (FGFR2)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oas04090]
    443548 (FGFR2)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    443548 (FGFR2)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     443548 (FGFR2)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   443548 (FGFR2)
CD molecules [BR:oas04090]
 Proteins
  443548 (FGFR2)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   443548 (FGFR2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 Ig_2 ig FGFR3_TM V-set Ig_5 Ig_4 C2-set_2 Herpes_gE Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 443548
NCBI-ProteinID: XP_011958426
Ensembl: ENSOARG00000005375
UniProt: A0A6P3T963
LinkDB
Position
22
AA seq 839 aa
MGLTSTWRYGRGQGIGTVTMVSWGRFLCLVVVTMATLSLARPSFNLVDDTTVEPEEPPTK
YQISQPEVYVAAPRESLELRCLLRDAAMISWTKDGVHLGPNNRTVLIGEYLQIKGATPRD
SGLYACTAARNVDSETVYFMVNVTDAISSGDDEDDADGSEDFVSENSNSKRAPYWTNTEK
MEKRLHAVPAANTVKFRCPAGGNPTPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESV
VPSDKGNYTCVVENDYGSINHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVY
SDAQPHIQWIKHVEKNGSKYGPDGLPYLKVLKHSGINSSNAEVLALFNVTEADAGEYICK
VSNYIGQANQSAWLTVLPKQQAPVREKEIPASPDYLEIAIYCIGVFFIACMVVTVILCRM
RNTTKKPDFSSQPAVHKLTKRIPLRRQVSAESSSSMNSNTPLVRITTRLSSTADTPMLAG
VSEYELPEDPKWEFPRDKLTLGKPLGEGCFGQVVMAEAVGIDKEKPKEAVTVAVKMLKDD
ATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPP
GMEYSYDINRVPEEQMAFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKI
ADFGLARDINNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGS
PYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILT
LTTNEEYLDLSQLLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHRNGSVKT
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgggattaacgtccacatggagatatggaagaggacaggggatcggcactgtaaccatg
gtcagctggggtcgcttcctctgcctggttgtggtcaccatggcaaccttgtccctggcc
cggccctccttcaatttagttgacgataccacggttgagccggaagagccaccaaccaaa
taccaaatctcccaaccagaagtttacgtggctgcgccccgggagtcgctagagttgcgc
tgcctgttgcgagatgccgccatgatcagttggactaaggatggggtacacttggggccc
aacaataggacagtgcttattggggagtatttgcagataaaaggtgccacgcctagagac
tccggcctctatgcttgtactgctgctaggaacgtagacagtgagactgtctacttcatg
gtcaatgttacagatgccatctcatccggagatgatgaggacgacgcagatggctcggag
gattttgtcagtgagaacagtaacagcaagagagcaccgtactggaccaacacagaaaag
atggaaaaacggctgcacgcggtcccagcagccaacactgtcaagttccgctgcccagct
ggggggaatccaacaccaaccatgaggtggctgaaaaacgggaaggaatttaagcaggag
catcgcattggaggctataaggtacgaaaccagcattggagccttattatggaaagtgtg
gtcccgtctgacaaaggaaattatacctgcgtggtggagaacgattacgggtccatcaat
catacgtaccacctcgacgttgttgagcgatcaccacaccggcccatcctccaagctggg
ctgccagcaaatgcctccactgtggttggaggcgatgtggagtttgtctgcaaagtgtac
agcgatgcccagccccatatccagtggatcaaacatgtggaaaagaacggcagtaaatac
gggcccgacgggctgccctatctcaaggttctgaagcactcggggataaatagttccaat
gcagaagtgctggctctgttcaatgtgactgaggcggatgctggggagtatatttgtaag
gtctccaattatatagggcaggccaaccagtctgcctggctcactgtcctgccaaaacag
caagctcctgtaagagaaaaggagatcccagcttccccagactacctggaaatagccatt
tactgcataggggtgttcttcatcgcctgcatggtggtgacagtcatcttgtgccggatg
aggaacacgaccaagaagccggacttcagcagccagccggctgtgcacaagctgaccaag
cgtatccccctgcggagacaggtttctgctgagtccagctcctctatgaactccaacacc
ccgttggtgaggattacaactcgtctctcttcaactgcagacacccccatgctggcaggg
gtctccgagtatgagctgccagaagatcccaaatgggagtttccaagagataagctgaca
ctgggcaaacccctgggagaaggttgctttgggcaagtggtcatggctgaagcagtggga
attgacaaggagaagcccaaggaagcagtcactgtggccgtgaagatgttgaaagatgat
gccactgagaaagacctttctgatctggtgtctgagatggagatgatgaagatgattggg
aaacacaaaaatatcataaatctccttggagcctgtactcaggatgggccgctctatgtc
atcgtcgagtacgcctcaaaaggcaatcttcgggaatacctccgcgcccggaggccaccg
gggatggagtattcctatgacatcaaccgcgttcccgaggagcagatggccttcaaggac
ttggtgtcgtgcacctaccagctggcccggggcatggagtacttggcttcccagaaatgc
attcatcgagatttagctgccagaaatgttttggtaacagaaaacaacgtgatgaaaata
gctgactttggactggccagagatatcaacaatatagactattacaaaaagaccacaaat
ggccgacttccggtcaagtggatggctcctgaagcccttttcgacagagtgtacacccat
cagagtgatgtctggtccttcggggtgttaatgtgggagatcttcacgttagggggctcg
ccctacccagggattcccgtggaggaactttttaagctgcttaaggaaggacataggatg
gacaagccagcaaactgcaccaacgaactgtatatgatgatgagagactgctggcatgca
gtaccctcacagagacccaccttcaagcagttggtagaagacttggatcgaattctcaca
ctcacaaccaacgaggaatacttggacctcagtcagcttcttgaacagtattcacctagt
taccctgacaccaggagttcttgctcttcgggagatgattctgttttctctccggacccc
atgccttacgaaccctgccttcctcagtatccacatagaaacggcagtgttaaaacatga

KEGG   Ovis aries (sheep): 780479
Entry
780479            CDS       T03117                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04072  Phospholipase D signaling pathway
oas04144  Endocytosis
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04520  Adherens junction
oas04540  Gap junction
oas04630  JAK-STAT signaling pathway
oas04810  Regulation of actin cytoskeleton
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04921  Oxytocin signaling pathway
oas04926  Relaxin signaling pathway
oas04928  Parathyroid hormone synthesis, secretion and action
oas04934  Cushing syndrome
oas05160  Hepatitis C
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    780479 (EGFR)
   04012 ErbB signaling pathway
    780479 (EGFR)
   04014 Ras signaling pathway
    780479 (EGFR)
   04015 Rap1 signaling pathway
    780479 (EGFR)
   04630 JAK-STAT signaling pathway
    780479 (EGFR)
   04066 HIF-1 signaling pathway
    780479 (EGFR)
   04068 FoxO signaling pathway
    780479 (EGFR)
   04020 Calcium signaling pathway
    780479 (EGFR)
   04072 Phospholipase D signaling pathway
    780479 (EGFR)
   04151 PI3K-Akt signaling pathway
    780479 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    780479 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    780479 (EGFR)
   04520 Adherens junction
    780479 (EGFR)
   04540 Gap junction
    780479 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    780479 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    780479 (EGFR)
   04915 Estrogen signaling pathway
    780479 (EGFR)
   04921 Oxytocin signaling pathway
    780479 (EGFR)
   04926 Relaxin signaling pathway
    780479 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    780479 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    780479 (EGFR)
   05206 MicroRNAs in cancer
    780479 (EGFR)
   05205 Proteoglycans in cancer
    780479 (EGFR)
   05230 Central carbon metabolism in cancer
    780479 (EGFR)
   05231 Choline metabolism in cancer
    780479 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    780479 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    780479 (EGFR)
   05212 Pancreatic cancer
    780479 (EGFR)
   05225 Hepatocellular carcinoma
    780479 (EGFR)
   05226 Gastric cancer
    780479 (EGFR)
   05214 Glioma
    780479 (EGFR)
   05218 Melanoma
    780479 (EGFR)
   05219 Bladder cancer
    780479 (EGFR)
   05215 Prostate cancer
    780479 (EGFR)
   05213 Endometrial cancer
    780479 (EGFR)
   05224 Breast cancer
    780479 (EGFR)
   05223 Non-small cell lung cancer
    780479 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    780479 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    780479 (EGFR)
   05171 Coronavirus disease - COVID-19
    780479 (EGFR)
   05163 Human cytomegalovirus infection
    780479 (EGFR)
   05165 Human papillomavirus infection
    780479 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    780479 (EGFR)
   01522 Endocrine resistance
    780479 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    780479 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    780479 (EGFR)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     780479 (EGFR)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   780479 (EGFR)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   780479 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   780479 (EGFR)
  Exosomal proteins of bladder cancer cells
   780479 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Borrelia_P83 APH Kinase-like Kdo
Other DBs
NCBI-GeneID: 780479
NCBI-ProteinID: XP_014957685
Ensembl: ENSOARG00000013753
UniProt: A0A6P3YMT1
LinkDB
Position
19
AA seq 1208 aa
MRLSRAGRAALLVLLAAHFPASLALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQSGYNLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALA
VLSNYGANKTGLRELPLRNLQEILQGAVRFSNNPVLCNMETIQWRDIINTDFLSNVTGDF
QNQQGNCSKCDPGCLNRSCWGAGEENCQKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRRFRDEATCKDTCPPLMLYDPTTYEMKVNPLGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSQEVEEDGVRKCKKCDGPCAKVCNGIGIGEFKDTLSINATNIKHFR
NCTSISGDLHILPVAFRGDSFTRTAPLDPKELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIISGNRNLCYANTIHWKKL
FGTSTQKTKILNNRSDKECKATGHICHPLCSSEGCWGPGPKYCMSCQNFSRGKECVGKCN
ILEGEPREFMENSECVQCHPECLPQAMNVTCTGRGPGNCVKCAHYIDGPHCVKTCPAGVA
GENGTLIWKFADASHVCHLCHPNCTYGCIGPGLEGCAANGPKIPSIATGIVGGLLLVLVL
ALSVGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKVKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTVLEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELILEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLVPQ
QGFFHSPATSRTPLLSSLSASSNTPTVTCVDRSGSYPLKEESFLQRYSSDPTGALTEDSM
DDAFLPVPEYVNQSVPKRPAGSVQNPVYHNQPLYPAPGRDPQYQNSRSNAVDNPEYLNTT
HPACINGVLDGPALWAQKGSHQISLDNPDYQQAFFPKEAKSNGIFKGPAAENTEYLRAAP
AGSDFTGA
NT seq 3627 nt   +upstreamnt  +downstreamnt
atgcgactctcgcgggcgggccgcgcggcgctcctggtgctgctggccgcgcacttcccg
gcgagtctagcgctggaggagaagaaagtttgccaagggacaagtaacaagctcacccag
ctgggcacttttgaagaccactttctgagcctccagaggatgttcaacaactgtgaggtg
gtccttgggaatttggaaattacctacatgcagagtggttacaacctttcttttctcaag
accatccaggaggttgccggctatgtactcattgccctcaacacagtggagaagattcca
ttggaaaacctgcagatcatccgaggaaatgtgctttatgaaaacacccatgccttagcc
gtcttatccaactatggagcaaacaaaaccggactgagggagctgcccttgagaaactta
caggaaattttgcaaggtgccgtgcgattcagtaacaaccctgtcctctgcaacatggag
accatccagtggcgggacatcatcaacactgattttctaagcaacgtgacaggggacttt
cagaaccagcagggcaactgctcgaagtgtgatccaggctgtctcaacagaagctgctgg
ggtgctggggaggagaactgccagaaattgaccaaaatcatctgtgcccagcagtgttcc
gggcgctgccgcggcaggtcccccagtgactgctgccacaaccagtgtgccgctggctgc
acggggccacgggagagcgactgcctggtctgccgcaggttccgtgatgaagccacctgc
aaggacacatgtccgccgctcatgctctatgaccctaccacctacgaaatgaaggtcaac
ccgctggggaaatacagctttggcgccacctgtgtcaagaagtgtccccggaactacgtg
gtgacagaccacggctcgtgcgtccgcgcctgcagctctgacagccaggaggtagaggaa
gatggtgtccgcaagtgcaaaaagtgcgacgggccttgtgccaaagtttgtaacggaata
ggaatcggtgagtttaaagacacactttccataaatgctacaaacattaaacacttcaga
aactgcacatccatcagtggagatcttcatatcctgccagtagcatttaggggggactcc
ttcacacgtactgcacctctggacccgaaagaactggacattctaaaaactgtaaaagaa
ataacagggtttttgctgattcaggcctggcccgaaaacaggactgacctccatgcgttt
gagaacctggaaatcatacgtggcagaacgaagcaacatggccagttttctcttgcggtt
gtcggcctggatataacatccttgggattacgctccctcaaggagataagtgatggcgat
gtgataatttcaggaaatcgaaacttgtgctatgcaaatacgatacactggaaaaaactt
tttgggacctcaactcagaaaaccaaaattttaaacaacaggagtgataaagagtgcaag
gccacgggccatatctgtcacccactgtgctcatcagagggctgctggggacctggaccc
aaatactgcatgtcctgccagaacttcagtcgtggcaaggagtgtgtgggaaagtgcaac
attctagagggagagcccagggagttcatggagaattccgagtgtgtgcagtgccatcca
gaatgcctgccccaggccatgaatgtgacctgcactggacgcggaccaggcaactgtgta
aagtgtgcccactacattgatggccctcactgcgtcaagacctgccctgctggagtcgcg
ggagagaatggcaccctgatctggaagtttgcagatgccagtcacgtgtgtcacctgtgc
caccccaactgcacctatggctgtatagggccaggtcttgaaggctgtgcagcaaatggg
cccaagatcccgtccattgccacgggcatcgtgggcggcctgctgctggtgttggtgctc
gccctgagcgtcggcctcttcatgcgcaggcgccacatcgtgcgcaagcgcacactgcgc
cggctgctgcaggagcgtgagctcgtggagcctctgacgcccagcggagaagctcctaac
caagctcttttgaggatcttaaaggaaacggaattcaaaaaagtcaaggtgttgggctca
ggagcattcggcaccgtgtacaagggactctggatcccagaaggcgagaaggttaaaatt
cctgtagctatcaaggaattaagagaagccacgtctcccaaagccaacaaggaaattctt
gatgaggcctacgtgatggccagtgtggacaacccacatgtgtgccgcctcctgggcatc
tgcctgacctccacagtgcagctcatcacacagctcatgcccttcggctgcctgctggac
tacgtccgtgagcacaaagacaacatcggctcccagtacctgctcaactggtgtgtgcag
atcgcaaagggcatgaattacctggaagaccggcgcttggtgcatagggacctggcagcc
aggaacgtgctggtgaagacgccgcagcacgtgaagatcacagacttcgggctggccaag
ctgctgggtgccgaggagaaggagtatcatgcagaaggaggcaaggtccctatcaaatgg
atggctttggaatcaattttacaccgaatttatacccatcagagtgatgtctggagctat
ggagtcactgtttgggagttgatgacctttggatccaagccttatgatggaatccctgcg
agtgagatctcaactgtcctggagaaaggagagcgcctcccacagccacccatctgcacc
atcgacgtctacatgatcatggtcaagtgctggatgatagatgcagacagtcgcccaaag
ttccgtgagttgatccttgaattctccaagatggcccgagacccacagcgctaccttgtc
atccagggggacgagagaatgcatttgccaagccctacggactccaacttttaccgcgcc
ctgatggatgaggaggacatggaggacgttgtggatgctgatgagtacctcgtcccccag
cagggcttcttccacagccccgccacctctcggacacccctcctcagctccctgagcgcc
tccagcaacactcccactgtgacttgcgttgatagaagtgggagctaccctctcaaggaa
gaaagcttcctgcagcgctacagttcagaccccactggtgccctcaccgaggacagcatg
gacgacgctttcctcccagtacccgaatatgtaaaccaatctgttcccaaaagacccgca
ggctctgtccagaaccctgtctatcacaatcagcctctatatccagctcctggcagagac
cctcagtaccaaaattcacgcagcaacgccgtggacaaccctgagtatctcaacaccacc
catcctgcctgtatcaatggtgtactcgacggccctgccctctgggctcagaagggcagt
caccaaattagcctagacaaccctgactaccagcaggccttttttcccaaggaagccaag
tcgaatggcatctttaagggacctgcagctgaaaatacagaatacctgcgggcagcacca
gcaggcagtgactttactggggcctga

KEGG   Ovis aries (sheep): 780507
Entry
780507            CDS       T03117                                 

Gene name
FGFR1
Definition
(RefSeq) fibroblast growth factor receptor 1 isoform X1
  KO
K04362  fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04520  Adherens junction
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04714  Thermogenesis
oas04810  Regulation of actin cytoskeleton
oas04928  Parathyroid hormone synthesis, secretion and action
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05215  Prostate cancer
oas05218  Melanoma
oas05224  Breast cancer
oas05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    780507 (FGFR1)
   04014 Ras signaling pathway
    780507 (FGFR1)
   04015 Rap1 signaling pathway
    780507 (FGFR1)
   04020 Calcium signaling pathway
    780507 (FGFR1)
   04151 PI3K-Akt signaling pathway
    780507 (FGFR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    780507 (FGFR1)
   04550 Signaling pathways regulating pluripotency of stem cells
    780507 (FGFR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    780507 (FGFR1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    780507 (FGFR1)
  09159 Environmental adaptation
   04714 Thermogenesis
    780507 (FGFR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    780507 (FGFR1)
   05205 Proteoglycans in cancer
    780507 (FGFR1)
   05230 Central carbon metabolism in cancer
    780507 (FGFR1)
  09162 Cancer: specific types
   05218 Melanoma
    780507 (FGFR1)
   05215 Prostate cancer
    780507 (FGFR1)
   05224 Breast cancer
    780507 (FGFR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    780507 (FGFR1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:oas04090]
    780507 (FGFR1)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    780507 (FGFR1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     780507 (FGFR1)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   780507 (FGFR1)
CD molecules [BR:oas04090]
 Proteins
  780507 (FGFR1)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   780507 (FGFR1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase I-set Ig_3 ig Ig_2 V-set FGFR3_TM Ig_5 C2-set_2 Ig_6 Pkinase_fungal DUF1615 DUF4611
Other DBs
NCBI-GeneID: 780507
NCBI-ProteinID: XP_027818429
Ensembl: ENSOARG00000001576
UniProt: A0A6P7DI18
LinkDB
Position
26
AA seq 822 aa
MWSRKCLLFWAVLVTATLCTAKPAPTLPEQAQPWGAPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLADSNRTRITGEEVEVRGSVPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRMPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHHPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSMPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHQAQLANGGLKRR
NT seq 2469 nt   +upstreamnt  +downstreamnt
atgtggagccggaagtgtctcctcttctgggccgtgctggtcacagccacgctctgcact
gccaagccggccccgaccttgccggagcaagcccagccctggggagcccccgtggaagtg
gagtccctcctggtccaccccggtgacctgctgcagctccgctgtcggctgcgggacgat
gttcagagcatcaactggctgcgggacggggtgcagctggcggacagcaaccgcacgcgc
atcaccggggaggaggtggaggttcggggctccgtgcccgccgactcaggcctctacgcc
tgcgtgaccagcagcccctccggcagtgacaccacctacttctctgtcaacgtctcagat
gcgctcccctcgtcggaggacgacgatgacgacgatgactcctcttccgaggagaaggaa
acagataacaccaaaccaaaccgtatgcccgtggctccgtactggacgtcaccagaaaag
atggaaaagaaactgcacgcggtgccagctgccaagacagtgaagttcaaatgcccttcc
agtgggaccccgaaccccacgctgcgctggctgaaaaacggcaaagaattcaagcctgac
cacaggatcggaggctacaaggtccgttatgccacctggagcatcattatggactccgtg
gtgccttcggataagggcaactacacctgcatcgtggagaacgaatacggcagcatcaac
catacctaccagctcgatgtcgtggagcggtcccctcaccggcccatcctgcaggcgggc
ttgccggccaacaagacggtggccctgggcagcaatgtggagttcatgtgcaaggtgtac
agtgacccacagccccacatccagtggctgaagcacatcgaggtgaacgggagtaagatt
gggccggacaacctgccttatgtccagatcttgaagacggccggagttaacaccaccgac
aaagagatggaggtgctgcacttaaggaatgtctcctttgaggacgcgggggagtataca
tgcttggcgggtaactctatcggactctcccatcactctgcatggctgaccgttctggaa
gccctggaagagagaccggcggtgatgacctcgccgctgtacctggagatcatcatctac
tgcacgggggccttcctcatctcctgcatggtgggctctgtcatcatctacaagatgaag
agcggcacaaagaagagtgacttccacagccagatggccgtgcacaagctagccaagagc
atccctctgcgcagacaggtaacagtgtcagccgactccagcgcgtccatgaactccggg
gtcttgctggttcggccctcgcgtctctcctccagcggcacccctatgctggccggggta
tctgaatatgagcttcctgaagaccctcgctgggagctgcctcgggacagactggtttta
ggcaagccactgggagagggctgctttgggcaggtggtgttggcggaggccatcgggctg
gacaaggacaaacccaaccgtgtgaccaaagtggccgtgaagatgctaaagtcggatgca
acagagaaagacctgtcggacctgatctctgagatggagatgatgaagatgattgggaaa
cacaagaacatcatcaacctgctgggggcctgcacacaggacggtcccctgtacgtcatc
gtggagtacgcctccaagggcaacctccgagagtacctgcaggcccggaggccgccaggg
ctggagtactgctacaaccccagccatcaccccgaggagcagctctcctccaaagacctg
gtgtcctgtgcctaccaggtggcccgaggcatggagtatcttgcctccaagaagtgcatc
caccgggacctggccgccaggaacgtcctggtgacggaggacaacgtgatgaagatcgcg
gacttcggtcttgctcgagacatccaccacatcgactactataaaaagacaaccaatggc
cgactgcccgtcaagtggatggcaccggaggccttgtttgaccggatctacacccaccag
agcgacgtgtggtcttttggggtgctcctctgggaaatcttcactctgggcggctcccca
taccctggggtccccgtggaggagcttttcaagctgctgaaggagggtcatcgtatggac
aagcccagtaactgcaccaacgagctctacatgatgatgagagactgctggcacgcagtc
ccctctcagagacccaccttcaagcagctggtggaagacctggaccgcatcgtggccttg
acctccaaccaggagtacctggacctgtcaatgcccctggaccaatattcccccagcttc
cccgacacccgaagctccacctgctcctccggggaggattccgtcttctctcacgagccc
ttgcccgaggaaccctgcctgccccgacaccaggcccagctggccaacggcggactcaaa
cggcgctga

KEGG   Ovis aries (sheep): 780519
Entry
780519            CDS       T03117                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04020  Calcium signaling pathway
oas04066  HIF-1 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04520  Adherens junction
oas04530  Tight junction
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05219  Bladder cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    780519 (ERBB2)
   04012 ErbB signaling pathway
    780519 (ERBB2)
   04066 HIF-1 signaling pathway
    780519 (ERBB2)
   04020 Calcium signaling pathway
    780519 (ERBB2)
   04151 PI3K-Akt signaling pathway
    780519 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    780519 (ERBB2)
   04520 Adherens junction
    780519 (ERBB2)
   04530 Tight junction
    780519 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    780519 (ERBB2)
   05206 MicroRNAs in cancer
    780519 (ERBB2)
   05205 Proteoglycans in cancer
    780519 (ERBB2)
   05230 Central carbon metabolism in cancer
    780519 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    780519 (ERBB2)
   05226 Gastric cancer
    780519 (ERBB2)
   05219 Bladder cancer
    780519 (ERBB2)
   05215 Prostate cancer
    780519 (ERBB2)
   05213 Endometrial cancer
    780519 (ERBB2)
   05224 Breast cancer
    780519 (ERBB2)
   05223 Non-small cell lung cancer
    780519 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    780519 (ERBB2)
   01524 Platinum drug resistance
    780519 (ERBB2)
   01522 Endocrine resistance
    780519 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    780519 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    780519 (ERBB2)
   04090 CD molecules [BR:oas04090]
    780519 (ERBB2)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     780519 (ERBB2)
Protein kinases [BR:oas01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   780519 (ERBB2)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   780519 (ERBB2)
CD molecules [BR:oas04090]
 Proteins
  780519 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like
Other DBs
NCBI-GeneID: 780519
NCBI-ProteinID: XP_014954244
Ensembl: ENSOARG00000011865
UniProt: A0A6P3YL94
LinkDB
Position
11
AA seq 1258 aa
MELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNL
ELTYLPADASLSFLQEIQEVQGYVLIAHNRVSQVPLQRLRIVRGTQLFEEHYALAVLDNG
DFLEGAAPAAGTASGGLQELQLRSLTEILKGGVLIQRNPQLCHQDTILWEDIFHKNNQLP
LKQIDTNRSRACAPCSPACKAPNCWGESSEDCQSLTRTVCASGCARCKGPQPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCAPVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFAGDPDSNITPLQAEQLKVFESLEEITGYLYISAWPDSLP
DLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLRELSSGLALIHRNARLCFVHTV
PWDQLFQNPHQALLHSANRPENECVGEGLACYPLCAQGHCWGPGPTQCVNCSQFLRGQEC
VEECRVLQGLQGLPREYVKDRYCLPCHPECLPQNGSVTCFGSEADQCVACAHYKDPPFCV
ARCPSGVKPDLSFMPIWKFPDEEGICQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAA
VVGVLLVVLVGLVFGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKE
TELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGV
GSPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLE
DVRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRR
RFTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVK
CWMIDSECRPRFRELVTEFSRMARDPQRFVVIQNEDLGPASPLDSTFYRSLLEDDDMGDL
VDAEEYLVPQQGFFCPDPAPGAGGTAHRRHRSTSTRSGGGELTLGLEPSEEEPPRSPLAP
SEGAGSDVFDGDLGMGAAKGLQSLPQHDSSPLQRYSEDPTVPLSPEADGYVAPSTCSPQP
EYVNQPEVRPQPPSPLEGPLPPPRPAGSTLERPKTLSPGKNGVVKDVFAFGAAVENPEYL
APRGRAAPQSHPSPAFSPAFDNLYYWDQDPSERGTPSSSFEGTPTAENPEYLGLDMPV
NT seq 3777 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccccccggagcc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggctgccagccagtcccgag
acccacctggacatgctacgccacctctaccaaggctgtcaggtggtgcagggtaacctg
gagctcacctatctgcctgctgatgccagcctctccttcctgcaggaaatccaggaggtg
cagggctatgtgctcatcgctcacaatcgagtgagtcaggtcccactgcagagactgcga
atcgtgcgaggcactcagctctttgaggaacactacgccctggccgtgctggacaatgga
gactttctggaaggtgctgcccctgctgcgggcacggcctcaggagggctgcaggagctg
cagctgcgaagcctcacagagatcctcaagggaggggtcttgatccagcggaacccccag
ctctgccaccaggacacgattttgtgggaggatatcttccacaagaacaaccagctgccc
ctcaagcagatagacaccaaccgctcacgggcctgcgcaccctgttctccagcttgtaaa
gctcccaactgctggggagaaagttctgaggactgtcagagcttgacgcggaccgtctgt
gccagtggctgtgcccgctgtaagggcccacagcccaccgactgctgccacgagcagtgc
gctgccggctgtactggccccaagcactctgactgcctggcctgcctccacttcaaccac
agcggtatctgtgagctgcactgcccagctctggtcacctacaacacggacaccttcgag
tcgatgcccaaccccgaggggcgttataccttcggtgccagctgtgtgaccgcctgtcct
tacaactacctgtctacggatgtgggatcctgcaccctggtttgtcccctgaacaaccaa
gaggtgacagctgaggatggaacccagaggtgtgagaaatgcagcaagccctgtgcccca
gtgtgctacggtctgggcatggaacacctgcgggaggtgagggcagtcaccagtgccaac
atccaggagtttgccggctgcaagaagatttttgggagcctggcgtttctgccagagagc
tttgcaggggacccagactctaacatcaccccactgcaggctgagcagctcaaagtgttt
gagtctctggaggagatcacaggttacctgtacatctcagcgtggccagacagcctgcct
gacctcagcgtcttccagaacctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgacgctgcaagggctgggcatcagctggctggggctgcgctcgctgcgggaa
ctgagcagcgggctggccctcatccaccgcaacgcccgcctctgcttcgtacacacggtg
ccctgggaccagctcttccagaacccccaccaggctctgctccacagcgccaacaggcca
gagaatgagtgcgtgggtgagggcctggcctgctacccactgtgcgcccaagggcactgc
tggggtcccgggcccacccagtgcgtcaactgcagccagttccttcggggccaggaatgc
gtggaggaatgccgagtactacagggactacaggggcttccccgggagtacgtgaaggac
aggtactgtctgccgtgccaccccgagtgtcttccccagaatggctcagtgacctgcttt
ggctcggaggctgaccaatgtgtggcttgtgcccactacaaggatcctcccttctgcgtg
gctcgctgccccagtggtgtgaagcctgacctctccttcatgcccatctggaagtttcca
gatgaagagggcatatgccagccatgccccatcaactgcacccactcctgtgtggacttg
gatgacaagggctgtcccgccgagcagagagccagccctgtgacatccatcattgccgct
gtggtgggcgttctgctggttgtccttgtggggctggtgttcggcatcctcattaagcga
aggcggcagaagatccggaagtatacaatgcggcggctgctgcaggagacggagctggtg
gagcccctgacgcccagcggagcgatgcccaatcaggctcagatgcggatcttaaaagag
acagagctgaggaaagtgaaggtgctaggatctggagcttttggcaccgtctacaagggc
atctggatccccgatggggaaaatgtgaaaatccccgtggccatcaaggtgttgagggaa
aacacatctcccaaagccaacaaggaaatcttggacgaagcatatgtgatggctggtgta
ggctccccatatgtgtcccgcctcctgggcatctgcctgacatccacagtgcagctggtg
acacagcttatgccctatggctgcctcctcgaccacgtccgagaacaccgtgggcgcctg
ggctcccaggacctgctgaactggtgtgtgcagattgccaaggggatgagctacttggag
gatgtgcggctcgtgcatagggacctggctgcccggaacgtgctggtcaagagtcccaac
catgtgaagattacagacttcgggctagcgcgactgctagacattgacgagacagagtac
cacgcagatgggggcaaggtgcccatcaagtggatggcattggagtccattctccgccgg
cggttcacccaccagagtgacgtgtggagctatggtgtgactgtgtgggagctgatgact
tttggggccaaaccttatgatgggatcccagcccgggagattcctgacctgctggagaag
ggagaacggctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaa
tgttggatgattgactctgaatgtcggccgaggttccgggagttagtgactgaattctcc
cgcatggccagggacccccagcgctttgtggtcatccagaatgaagacttgggccctgct
agccccctggatagcaccttctaccgctcgctgctggaggatgacgacatgggagacctg
gtggatgcggaggagtacctggtaccccagcagggcttcttctgcccagaccctgcccca
ggagctggaggcacggcccaccgcaggcaccgcagcacatccaccaggagtggtggtggt
gagctgacactggggctggagccctctgaggaggagccccccagatctccgctggcacct
tccgaaggggcaggctctgatgtgtttgatggcgacttgggaatgggggcggccaagggg
ctgcagtccctcccccaacacgactctagccctctacagcggtacagcgaggaccccaca
gtacccctttctcccgaggctgatggctacgttgccccctcgacctgcagcccccagccc
gaatacgtgaaccagccagaggttcgcccacagcccccgtcacccctagagggtcctctg
ccgcctcctcgacctgcaggttccactctggaaaggcccaagacgctctcccctgggaag
aatggggttgtcaaagacgtttttgcctttggggctgccgtggagaaccccgagtacttg
gcaccccggggcagggccgcccctcagtcccacccttctccagccttcagcccagccttt
gacaacctctactactgggaccaggacccatcagagcggggcactccatccagctccttt
gaagggacccctacggcagagaaccctgagtacctgggcctggacatgccagtatga

DBGET integrated database retrieval system