KEGG   Ovis aries (sheep): 101106433
Entry
101106433         CDS       T03117                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin-1 isoform X1
  KO
K16857  thrombospondin 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04015  Rap1 signaling pathway
oas04115  p53 signaling pathway
oas04145  Phagosome
oas04151  PI3K-Akt signaling pathway
oas04350  TGF-beta signaling pathway
oas04510  Focal adhesion
oas04512  ECM-receptor interaction
oas05144  Malaria
oas05165  Human papillomavirus infection
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101106433 (THBS1)
   04350 TGF-beta signaling pathway
    101106433 (THBS1)
   04151 PI3K-Akt signaling pathway
    101106433 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101106433 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101106433 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    101106433 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101106433 (THBS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101106433 (THBS1)
   05205 Proteoglycans in cancer
    101106433 (THBS1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101106433 (THBS1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101106433 (THBS1)
  09174 Infectious disease: parasitic
   05144 Malaria
    101106433 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101106433 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    101106433 (THBS1)
   04990 Domain-containing proteins not elsewhere classified [BR:oas04990]
    101106433 (THBS1)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101106433 (THBS1)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101106433 (THBS1)
Domain-containing proteins not elsewhere classified [BR:oas04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   101106433 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC cEGF EGF_3 TSP1_ADAMTS EGF_CA Laminin_G_3 TSP1_CCN Laminin_G_2 EGF Laminin_G_1
Other DBs
NCBI-GeneID: 101106433
NCBI-ProteinID: XP_027827464
Ensembl: ENSOARG00000020058
UniProt: A0A6P7EA57
LinkDB
Position
7
AA seq 1171 aa
MGLAWGLGVLLLVHACGSNRIPESGGDNSVFDIFELTGAARKGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDKKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAVERKDHSGQVFSVV
SNGKAGTLDLSLTVQGKQHVVSVEEALLATGQWKSITLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLASIARLRIAKGGVNDNFQGVLQNVRFVFGTTPEDILRNKGCSSSATSVF
LTLDNNVVNGSSPAIRTDYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIR
KVTEENKELANELRRPPLCYHNGVQYRTGDEWTVDSCTECRCQNSVTICKKVSCPIMPCS
NATVPDGECCPRCWPSDSADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQ
TRTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGKAR
ETKACQKDACPINGGWGPWSPWDICSVTCGGGAQKRSRLCNNPTPQFGGKDCVGDVTETQ
ICNKQDCPIDGCLSNPCFAGVQCTSYPDGSWKCGACPPGYSGDGVKCEDVDECKEVPDAC
FNHNGEHRCENTDPGYNCLPCPPRFTGSQPFGRGVEHATANKQVCKPRNPCTDGTHDCNK
NAKCNYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLLCVANATYHCRKDNCP
NLPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPY
NHNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQKDTDMDGVGDQCDNCPLE
HNPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDD
NDGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDQDKVPDIDDICPENVDISETDFRR
FQMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERD
DDYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNA
LWHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIY
DKTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3516 nt   +upstreamnt  +downstreamnt
atggggctggcctggggactcggtgtcctgctcctcgtgcatgcctgcggctccaaccgc
attccagagtctgggggagacaacagtgtgtttgacatctttgaactcaccggagctgcc
cgcaagggctctgggcgccgactggtgaagggtcctgacccttctagcccagctttccgc
atcgaggatgccaacctgatcccccctgtgcctgacaagaagttccaagacctagtggat
gctgtgcgggcggagaaaggtttcctcctcctggcttccctgaggcaaatgaagaagacc
cgaggtaccctgctggctgtggagcggaaagaccactctggccaggtcttcagcgtggtc
tccaatggcaaagcgggcaccctggacctgagcctgaccgtgcagggcaagcagcacgtg
gtgtcggtagaggaagcactcctggcgactggccagtggaagagcatcaccctatttgtg
caggaggacagggcccagctgtacatcgactgtgagaagatggagaatgcggagctggat
gtccccatccagagcatcttcaccagggacctggccagcatcgccagactccgcattgcc
aaaggaggcgtcaatgacaatttccagggggtgctgcagaatgtaaggtttgtctttgga
accacaccagaagacatcctcaggaacaaaggctgctccagctcagctaccagtgtcttt
ctcacccttgacaacaatgtggtgaatgggtccagccctgccatccgcaccgactacatc
ggccacaagacaaaggacctgcaagccatttgtggcatctcatgtgacgagctgtccagc
atggtcctagagctcaggggtctacgcaccattgtgaccacgctgcaggacagtatccgc
aaagtgaccgaagagaacaaagagctggccaatgagctgaggaggcccccactctgctac
cacaacggagtccagtacaggactggtgacgagtggacggtggacagctgcactgagtgt
cgctgccagaactcagttaccatctgcaaaaaagtgtcctgtcccatcatgccctgctcc
aacgccacagttcctgatggagaatgctgcccacggtgctggcccagcgactctgcagac
gatggctggtccccgtggtctgagtggacctcttgctctgtgacctgtggcaatggaatc
cagcagcgtggccgctcctgcgacagcctcaacaacagatgcgagggctcctctgtgcag
acgcggacctgccacatccaggagtgtgacaagagatttaaacaggatggaggctggagc
cactggtccccgtggtcatcttgttccgtaacatgtggagatggtgtgatcacaaggatc
cggctctgcaactcccccagcccccagatgaatgggaagccatgtgagggcaaagcccgg
gagaccaaagcctgccagaaagacgcctgccccatcaatggaggctggggcccctggtca
ccatgggacatctgttctgtcacctgcggaggaggggcacagaaacgtagccggctctgc
aacaaccccacgccccagtttggaggcaaggactgcgttggtgatgtaacagaaacccag
atctgcaacaagcaggactgtcccattgatggctgcctgtccaatccctgctttgctggt
gtccagtgtaccagctaccctgatggcagctggaagtgtggtgcttgtcccccaggctat
agcggagatggcgtcaagtgcgaagatgttgatgagtgcaaagaagttcctgatgcctgc
ttcaaccacaatggagagcacaggtgtgagaacacagaccccggctacaactgcctgccc
tgcccaccacgcttcactggctcgcagcccttcggccggggcgtggaacatgccaccgcc
aacaaacaggtatgcaagccccgaaacccctgcacggacgggacacatgactgcaacaag
aacgccaagtgcaactacctgggccactacagtgaccccatgtaccgctgcgagtgcaag
cctggctacgccggcaacggcatcatctgcggggaggacacagacctggacggctggccc
aacgaggacctgctgtgcgtggccaatgcaacttaccactgcagaaaggataattgcccc
aaccttcccaactcagggcaggaagactatgacaaggatggaatcggcgatgcctgtgat
gatgacgatgacaatgataagattccagatgacagggacaactgtccattccattacaac
ccagcccagtatgactatgacagagatgacgtgggagaccgctgtgacaactgcccctac
aaccacaacccagaccaggctgacacagataacaatggggaaggagacgcctgcgcagct
gacattgatggggacggtatcctcaatgaacgggacaactgccagtatgtctacaatgtg
gaccagaaagacactgacatggacggggttggtgaccagtgtgacaactgccccctggaa
cacaatccagaccagctcgactctgactcggaccgcattggagacacctgtgacaacaat
caggatattgatgaagacggccaccagaacaacctggacaactgtccctacgtgcccaat
gccaaccaggccgaccacgacaaggatggcaaaggcgatgcctgcgaccacgatgatgac
aacgatggcattcctgatgaccgggacaactgcaggctggtgcccaatcctgaccagaag
gactctgatggtgatggtcgaggtgatgcttgcaaagatgattttgaccaggacaaggtg
ccagacattgatgacatctgtcccgaaaatgttgatatcagtgagactgatttccgccga
ttccagatgattcctctagatcccaaagggacatcccagaatgaccctaactgggttgta
cgccatcagggtaaagaactcgtccagactgtcaactgtgaccctggacttgctgtaggt
tatgacgaatttaatgctgtggacttcagcgggaccttcttcatcaacaccgagagggat
gacgactatgccggctttgtgtttggctaccagtccagcagccgcttctatgttgtgatg
tggaagcaagtcactcaatcctattgggacaccaaccccacgagggctcagggatactct
ggactttctgtgaaagttgtgaactccaccacggggcctggcgagcacctgcggaatgcc
ctgtggcacacaggaaacacccctggccaggtgcgcacactgtggcatgaccctcgtcac
attggctggaaagatttcactgcctacagatggcgtctgagccacaggccaaagacaggt
ttcatcagagtggtgatgtatgaagggaagaaaatcatggctgactcaggacccatctat
gacaaaacctatgctggtggtaggctaggcttgttcgtcttctctcaagaaatggtgttc
ttctccgacctgaaatatgaatgcagagattcctaa

DBGET integrated database retrieval system