KEGG   Ovis aries (sheep): 101106508
Entry
101106508         CDS       T03117                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04915  Estrogen signaling pathway
oas05200  Pathways in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05223  Non-small cell lung cancer
oas05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101106508 (TGFA)
   04012 ErbB signaling pathway
    101106508 (TGFA)
   04014 Ras signaling pathway
    101106508 (TGFA)
   04151 PI3K-Akt signaling pathway
    101106508 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101106508 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101106508 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101106508 (TGFA)
   05212 Pancreatic cancer
    101106508 (TGFA)
   05225 Hepatocellular carcinoma
    101106508 (TGFA)
   05214 Glioma
    101106508 (TGFA)
   05211 Renal cell carcinoma
    101106508 (TGFA)
   05215 Prostate cancer
    101106508 (TGFA)
   05223 Non-small cell lung cancer
    101106508 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101106508 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 101106508
NCBI-ProteinID: XP_027822773
Ensembl: ENSOARG00000011111
LinkDB
Position
3
AA seq 176 aa
FPFEKDPSLKPEKLAAGQTLTCLLFSLFAGIFLAVCQALENSTSALSADPPVAAAVVSHF
NDCPASHSQFCFHGTCRFLVQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALV
VVSIVALAVLIITCVLIHCCEVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 531 nt   +upstreamnt  +downstreamnt
tttccctttgagaaggacccgtccttgaagcctgagaagttggctgctgggcagactctc
acctgtcttcttttctccctcttcgcaggtattttcttggccgtgtgccaggccctggag
aacagcacatccgccctgagtgcagacccgcccgtggctgcagctgtggtgtcccatttt
aatgactgcccagcttcccacagtcagttctgcttccatggaacctgcaggtttttggtg
caggaggagaagccagcgtgtgtctgccactctgggtacgtcggtgcacgctgtgaacac
gcagacctcctggccgtggtggctgccagccagaagaagcaggccatcaccgccttggtg
gtggtctccatcgtggccctggctgtcctcatcatcacatgtgtgctgatacactgctgt
gaggtccgaaaacactgtgagtggtgccgggcgctcatctgccggcatgagaagcccagc
gccctcctgaagggaaggactgcttgctgccactcagaaacagtggtctga

DBGET integrated database retrieval system