KEGG   Ovis aries (sheep): 101106508
Entry
101106508         CDS       T03117                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04915  Estrogen signaling pathway
oas05200  Pathways in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05223  Non-small cell lung cancer
oas05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101106508 (TGFA)
   04012 ErbB signaling pathway
    101106508 (TGFA)
   04014 Ras signaling pathway
    101106508 (TGFA)
   04151 PI3K-Akt signaling pathway
    101106508 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    101106508 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101106508 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101106508 (TGFA)
   05212 Pancreatic cancer
    101106508 (TGFA)
   05225 Hepatocellular carcinoma
    101106508 (TGFA)
   05214 Glioma
    101106508 (TGFA)
   05211 Renal cell carcinoma
    101106508 (TGFA)
   05215 Prostate cancer
    101106508 (TGFA)
   05223 Non-small cell lung cancer
    101106508 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101106508 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 101106508
NCBI-ProteinID: XP_027822773
Ensembl: ENSOARG00000011111
UniProt: A0A6P7DVE6
LinkDB
Position
3
AA seq 176 aa
FPFEKDPSLKPEKLAAGQTLTCLLFSLFAGIFLAVCQALENSTSALSADPPVAAAVVSHF
NDCPASHSQFCFHGTCRFLVQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALV
VVSIVALAVLIITCVLIHCCEVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 531 nt   +upstreamnt  +downstreamnt
tttccctttgagaaggacccgtccttgaagcctgagaagttggctgctgggcagactctc
acctgtcttcttttctccctcttcgcaggtattttcttggccgtgtgccaggccctggag
aacagcacatccgccctgagtgcagacccgcccgtggctgcagctgtggtgtcccatttt
aatgactgcccagcttcccacagtcagttctgcttccatggaacctgcaggtttttggtg
caggaggagaagccagcgtgtgtctgccactctgggtacgtcggtgcacgctgtgaacac
gcagacctcctggccgtggtggctgccagccagaagaagcaggccatcaccgccttggtg
gtggtctccatcgtggccctggctgtcctcatcatcacatgtgtgctgatacactgctgt
gaggtccgaaaacactgtgagtggtgccgggcgctcatctgccggcatgagaagcccagc
gccctcctgaagggaaggactgcttgctgccactcagaaacagtggtctga

KEGG   Ovis aries (sheep): 101112600
Entry
101112600         CDS       T03117                                 

Gene name
PDGFC
Definition
(RefSeq) platelet-derived growth factor C isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04072  Phospholipase D signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04810  Regulation of actin cytoskeleton
oas05215  Prostate cancer
oas05218  Melanoma
oas05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101112600 (PDGFC)
   04014 Ras signaling pathway
    101112600 (PDGFC)
   04015 Rap1 signaling pathway
    101112600 (PDGFC)
   04020 Calcium signaling pathway
    101112600 (PDGFC)
   04072 Phospholipase D signaling pathway
    101112600 (PDGFC)
   04151 PI3K-Akt signaling pathway
    101112600 (PDGFC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101112600 (PDGFC)
   04540 Gap junction
    101112600 (PDGFC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101112600 (PDGFC)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101112600 (PDGFC)
  09162 Cancer: specific types
   05218 Melanoma
    101112600 (PDGFC)
   05215 Prostate cancer
    101112600 (PDGFC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101112600 (PDGFC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    101112600 (PDGFC)
Cytokines and growth factors [BR:oas04052]
 Growth factors
  Growth factors (RTK binding)
   101112600 (PDGFC)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 101112600
NCBI-ProteinID: XP_027812139
Ensembl: ENSOARG00000006586
UniProt: A0A6P7D1T5
LinkDB
Position
17
AA seq 397 aa
MGVCGKCPARLGGQSRRGASRPARPSPGGADPGPEPRSPSARRPRARPLSPMLLFGLLLL
TSALAGQRPGTRAESNLSSKLQLGSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPR
NMDLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTILGRWCGSGSV
PGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQLTETVSPSSLPASALPLDLLNNA
VTAFSTLEDLIRYLEPDRWQLDLEDLYRPTSLQLLGKNYMFGRKSRVVDLNLLKEEVRLY
SCTPRNFSVSVREELKRTDTIFWPGCLLVKRCGGNCACCLQTCSECQCVPSKVTKKYHEV
LQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGNPGG
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgggagtatgtggaaagtgccccgcgaggctcggcggccagagcaggcgcggcgcgtcc
cgcccggcgcggccctcccccggcggcgctgatcccggcccggagccccgctccccaagt
gcccgccgaccgcgcgcccgcccgctcagcccaatgctcctcttcgggctcctcctgctg
acatccgccctagccggccagagacccgggacccgggctgagtccaacctgagcagcaaa
ctccagctcggcagcaacaaggagcagaacggtgtacaagatccccagcatgagagaatt
attactgtgtctactaatggaagtattcacagcccaaggtttcctcatacttatccaaga
aatatggacttggtatggagattagtagcagtagaagaaaatgtgtggatacagctcaca
tttgatgagagatttgggcttgaagacccagaagatgacatatgcaagtatgattttgta
gaggttgaagaaccaagtgatggaaccattttagggcgctggtgtgggtctggcagtgtg
ccaggaaagcagatttctaaaggaaatcaaatcaggatcagatttgtatctgatgagtat
tttccctcggagcccgggttctgcatccactacaacattgtcatgccacagctcacagaa
actgtgagtccgtcctcgctgcccgcctcagccttgccactggacctcctgaataacgcc
gtcactgcctttagtaccttggaagacctcattcggtatcttgaaccagacagatggcaa
ttagacttagaagatctctacaggcccacttctttgcaactgctgggcaagaattacatg
tttggaagaaaatccagagtggtggacctgaacctgctcaaggaggaggtgcggctctac
agctgcacgccccgcaacttctctgtgtccgtccgggaggagctgaagaggaccgacacc
atcttctggcctggctgcctcctggtgaagcgctgtggcgggaactgcgcgtgctgcctg
cagacctgcagcgagtgtcagtgtgtccccagcaaggtcaccaagaagtatcacgaggtc
cttcagttgagacccaagacaggcgtccgggggctgcataagtcactcacggacgtggcc
ctcgagcaccatgaggagtgtgactgcgtttgcagggggaaccctgggggataa

KEGG   Ovis aries (sheep): 101117784
Entry
101117784         CDS       T03117                                 

Gene name
PDGFD
Definition
(RefSeq) platelet-derived growth factor D isoform X1
  KO
K05450  platelet derived growth factor C/D
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04072  Phospholipase D signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04810  Regulation of actin cytoskeleton
oas05215  Prostate cancer
oas05218  Melanoma
oas05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101117784 (PDGFD)
   04014 Ras signaling pathway
    101117784 (PDGFD)
   04015 Rap1 signaling pathway
    101117784 (PDGFD)
   04020 Calcium signaling pathway
    101117784 (PDGFD)
   04072 Phospholipase D signaling pathway
    101117784 (PDGFD)
   04151 PI3K-Akt signaling pathway
    101117784 (PDGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101117784 (PDGFD)
   04540 Gap junction
    101117784 (PDGFD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101117784 (PDGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101117784 (PDGFD)
  09162 Cancer: specific types
   05218 Melanoma
    101117784 (PDGFD)
   05215 Prostate cancer
    101117784 (PDGFD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101117784 (PDGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    101117784 (PDGFD)
Cytokines and growth factors [BR:oas04052]
 Growth factors
  Growth factors (RTK binding)
   101117784 (PDGFD)
SSDB
Motif
Pfam: CUB PDGF
Other DBs
NCBI-GeneID: 101117784
NCBI-ProteinID: XP_004016014
Ensembl: ENSOARG00000003293
UniProt: W5NZA8 A0A6P3EA37
LinkDB
Position
15
AA seq 370 aa
MHRLILVYTLVCANFCSYRDTSATPQSASIKALRNANLRRDESNHLTDLYRRDETIQVTG
HGHVQSPRFPNSYPRNLLLTWRLHSQEKTRIQLAFDNQFGLEEAENDICRYDFVEVEDIS
ETSTVIRGRWCGHKEVPPRITSRTNQIKITFKSDDYFVAKPGFKIYYSFVEDFQPAAASE
TNWESVTSSISGVSYHSPSVTDPTLTADALDKTIAEFDTVEELLKHFNPESWQDDLENLY
LDTPHHRGRSYHDRKSKVDLDRLNDDVKRYSCTPRNYSVNLREELKLTNVVFFPRCLLVQ
RCGGNCGCGTVNWKSCACNSGKTVKKYHEVLKFEPGHFKRRGRAKHMALVDIQLDHHERC
DCICSSRPPR
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcaccggctcatccttgtctacacgctagtctgcgcaaacttttgcagctaccgggac
acctctgccaccccgcagagcgcatctatcaaagctttgcgtaacgccaacctcaggcga
gatgagagcaatcacctcacagacttgtaccgaagagacgagaccatccaggtgacagga
cacggccacgtgcagagtccccgcttcccaaacagctaccctcgcaacctgcttctgacc
tggcggctccactcccaggagaaaacaaggatacagctagcctttgacaatcagtttgga
ttagaggaagcggaaaatgatatctgtaggtatgattttgtagaagttgaagacatatct
gaaaccagtactgttattagaggacgatggtgtggacacaaggaagttcctccaaggata
acatcaagaacaaaccagattaaaataacgttcaagtctgatgactactttgtggctaaa
cctggattcaagatttattattcttttgtggaagatttccaacctgcagcagcctcagag
accaactgggagtcagtcacaagctctatctcaggggtatcctatcactctccatcagta
acggaccccactctcactgcggatgctctggacaaaacgattgcagaatttgatactgtg
gaagagctgctcaagcacttcaatcccgaatcatggcaagacgatcttgagaatctgtat
ttggatacccctcatcatcgaggcagatcgtatcatgacaggaagtcaaaagttgacctg
gacaggctcaacgatgatgtcaagcgttacagttgcactcccaggaattactccgtcaac
ttgagagaagagctgaagcttaccaatgtggtcttctttccacgctgcctccttgtgcag
cgctgcggaggaaactgtggctgtggaactgtcaactggaagtcctgtgcgtgcaattca
gggaaaactgtgaaaaagtatcacgaggtgttaaagtttgaacctggccatttcaagagg
aggggcagagcgaagcacatggctctcgttgacatccagttggatcatcatgagcggtgc
gactgtatctgcagctcaagaccacctcgataa

KEGG   Ovis aries (sheep): 114110121
Entry
114110121         CDS       T03117                                 

Gene name
INS
Definition
(RefSeq) insulin
  KO
K04526  insulin
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04072  Phospholipase D signaling pathway
oas04114  Oocyte meiosis
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04911  Insulin secretion
oas04913  Ovarian steroidogenesis
oas04914  Progesterone-mediated oocyte maturation
oas04917  Prolactin signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04930  Type II diabetes mellitus
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04940  Type I diabetes mellitus
oas04950  Maturity onset diabetes of the young
oas04960  Aldosterone-regulated sodium reabsorption
oas05010  Alzheimer disease
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114110121 (INS)
   04014 Ras signaling pathway
    114110121 (INS)
   04015 Rap1 signaling pathway
    114110121 (INS)
   04066 HIF-1 signaling pathway
    114110121 (INS)
   04068 FoxO signaling pathway
    114110121 (INS)
   04072 Phospholipase D signaling pathway
    114110121 (INS)
   04022 cGMP-PKG signaling pathway
    114110121 (INS)
   04151 PI3K-Akt signaling pathway
    114110121 (INS)
   04152 AMPK signaling pathway
    114110121 (INS)
   04150 mTOR signaling pathway
    114110121 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    114110121 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    114110121 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114110121 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    114110121 (INS)
   04910 Insulin signaling pathway
    114110121 (INS)
   04923 Regulation of lipolysis in adipocytes
    114110121 (INS)
   04913 Ovarian steroidogenesis
    114110121 (INS)
   04914 Progesterone-mediated oocyte maturation
    114110121 (INS)
   04917 Prolactin signaling pathway
    114110121 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    114110121 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    114110121 (INS)
   04213 Longevity regulating pathway - multiple species
    114110121 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    114110121 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    114110121 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    114110121 (INS)
   04940 Type I diabetes mellitus
    114110121 (INS)
   04950 Maturity onset diabetes of the young
    114110121 (INS)
   04932 Non-alcoholic fatty liver disease
    114110121 (INS)
   04931 Insulin resistance
    114110121 (INS)
SSDB
Motif
Pfam: Insulin Ins_beta
Other DBs
NCBI-GeneID: 114110121
NCBI-ProteinID: XP_027815630
UniProt: A0A6P7DA61
LinkDB
Structure
PDB: 
6CE9 6CEB 6CE7

Position
21
AA seq 105 aa
MALWTRLVPLLALLALWAPAPARAFVNQHLCGSHLVEALYLVCGERGFFYTPKARREVEG
PQVGALELAGGPGAGGLEGPPQKRGIVEQCCAGVCSLYQLENYCN
NT seq 318 nt   +upstreamnt  +downstreamnt
atggccctgtggacacgcctggtgcccctgctggccctgctggcgctctgggcccccgcc
ccggcccgcgccttcgtcaaccagcacctgtgcggctcccacctggtggaggcgctgtac
ctggtgtgcggagagcgcggcttcttctacacgcccaaggcccgccgggaggtggagggc
ccccaggtgggggcgctggagctggccggaggccccggcgcgggcggcctggaggggccc
ccgcagaagcgtggcatcgtggagcagtgctgcgccggcgtctgctctctctaccagctg
gagaactactgtaactag

KEGG   Ovis aries (sheep): 114110564
Entry
114110564         CDS       T03117                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04072  Phospholipase D signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04630  JAK-STAT signaling pathway
oas04810  Regulation of actin cytoskeleton
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05206  MicroRNAs in cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05231  Choline metabolism in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114110564 (PDGFA)
   04014 Ras signaling pathway
    114110564 (PDGFA)
   04015 Rap1 signaling pathway
    114110564 (PDGFA)
   04630 JAK-STAT signaling pathway
    114110564 (PDGFA)
   04020 Calcium signaling pathway
    114110564 (PDGFA)
   04072 Phospholipase D signaling pathway
    114110564 (PDGFA)
   04151 PI3K-Akt signaling pathway
    114110564 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114110564 (PDGFA)
   04540 Gap junction
    114110564 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    114110564 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114110564 (PDGFA)
   05202 Transcriptional misregulation in cancer
    114110564 (PDGFA)
   05206 MicroRNAs in cancer
    114110564 (PDGFA)
   05231 Choline metabolism in cancer
    114110564 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    114110564 (PDGFA)
   05218 Melanoma
    114110564 (PDGFA)
   05215 Prostate cancer
    114110564 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    114110564 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114110564 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    114110564 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    114110564 (PDGFA)
Cytokines and growth factors [BR:oas04052]
 Growth factors
  Growth factors (RTK binding)
   114110564 (PDGFA)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   114110564 (PDGFA)
SSDB
Motif
Pfam: PDGF_N PDGF
Other DBs
NCBI-GeneID: 114110564
NCBI-ProteinID: XP_027817095
UniProt: A0A6P7DEE9
LinkDB
Position
24
AA seq 211 aa
MRTWACLLLLGCGYLANALAEEAEIPREVIERLAHSQIHSIRDLQRLLEIDSVGAEEPLE
TSLRAHGGHGARHGPERRLVPIRRKRSIEEAIPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRVHHRNVKVAKVEYFRKKAKLKEVQVRLEEHLECACT
SASPSPERREEEAGRRRESGKKRKRKRLKPT
NT seq 636 nt   +upstreamnt  +downstreamnt
atgaggacctgggcttgtctgctgctcctcggctgcgggtacctcgccaatgccctggcc
gaggaagccgagatcccccgcgaggtcattgagaggctggcgcacagtcagatccacagc
atccgggacctccagcgactcctggagatagactccgtaggagctgaggagcctttggaa
accagtctgagagcccacgggggccacggcgctaggcatggcccggagaggcggctggtg
cccatccggaggaagaggagcatcgaggaggccatcccggcggtctgcaagaccaggact
gtcatttacgagatacctcggagccaggtggaccccacgtccgctaacttcctgatctgg
ccgccgtgcgtggaggtgaagcgctgcaccggctgctgtaacaccagcagcgtcaagtgc
cagccgtcacgcgtccaccaccggaacgtcaaggtggccaaggtggagtacttcaggaag
aaggcgaagttgaaagaggtgcaggtgcggctggaggagcacctggagtgtgcgtgcacc
agcgccagcccgagccccgagcgccgcgaggaggaggcgggaaggcgtagggagtcaggt
aaaaaacggaaaagaaaaaggttaaaacccacctaa

KEGG   Ovis aries (sheep): 443318
Entry
443318            CDS       T03117                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I precursor
  KO
K05459  insulin-like growth factor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04114  Oocyte meiosis
oas04115  p53 signaling pathway
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04730  Long-term depression
oas04750  Inflammatory mediator regulation of TRP channels
oas04913  Ovarian steroidogenesis
oas04914  Progesterone-mediated oocyte maturation
oas04935  Growth hormone synthesis, secretion and action
oas04960  Aldosterone-regulated sodium reabsorption
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05205  Proteoglycans in cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05224  Breast cancer
oas05410  Hypertrophic cardiomyopathy
oas05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    443318 (IGF1)
   04014 Ras signaling pathway
    443318 (IGF1)
   04015 Rap1 signaling pathway
    443318 (IGF1)
   04066 HIF-1 signaling pathway
    443318 (IGF1)
   04068 FoxO signaling pathway
    443318 (IGF1)
   04151 PI3K-Akt signaling pathway
    443318 (IGF1)
   04152 AMPK signaling pathway
    443318 (IGF1)
   04150 mTOR signaling pathway
    443318 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    443318 (IGF1)
   04115 p53 signaling pathway
    443318 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    443318 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    443318 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    443318 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    443318 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    443318 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    443318 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    443318 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    443318 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    443318 (IGF1)
   04213 Longevity regulating pathway - multiple species
    443318 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443318 (IGF1)
   05202 Transcriptional misregulation in cancer
    443318 (IGF1)
   05205 Proteoglycans in cancer
    443318 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    443318 (IGF1)
   05218 Melanoma
    443318 (IGF1)
   05215 Prostate cancer
    443318 (IGF1)
   05224 Breast cancer
    443318 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    443318 (IGF1)
   05414 Dilated cardiomyopathy
    443318 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    443318 (IGF1)
   01522 Endocrine resistance
    443318 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443318 (IGF1)
Cytokines and growth factors [BR:oas04052]
 Growth factors
  Growth factors (RTK binding)
   443318 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 443318
NCBI-ProteinID: NP_001009774
UniProt: P10763 A0FJ28
LinkDB
Position
3
AA seq 154 aa
MGKISSLPTQLFKCCFCDFLKQVKMPVTSSSHLFYLALCLLAFSSSATAGPETLCGAELV
DALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKAAKSAR
SVRAQRHTDMPKAQKEVHLKNTSRGSAGNKNYRM
NT seq 465 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aagcaggtgaagatgccagtcacatcctcctcgcatctcttctatctggccctgtgcttg
ctcgccttcagcagctctgccacggcgggacctgagaccctctgcggggctgagttggtg
gatgctctccagttcgtgtgcggagacaggggcttttatttcaacaagcccacggggtac
ggctcgagcagtcggagggcgccccagacaggaatcgtggatgagtgctgcttccggagc
tgtgatctgaggaggctggagatgtactgtgcgcctctcaaggccgccaagtcggcccgc
tcagtccgtgcccagcgccacaccgacatgcccaaggctcagaaggaagtacatttgaag
aacacaagcagagggagtgcaggaaacaagaactacagaatgtag

KEGG   Ovis aries (sheep): 443545
Entry
443545            CDS       T03117                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B precursor
  KO
K17386  platelet-derived growth factor subunit B
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04072  Phospholipase D signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04510  Focal adhesion
oas04540  Gap junction
oas04630  JAK-STAT signaling pathway
oas04810  Regulation of actin cytoskeleton
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05206  MicroRNAs in cancer
oas05211  Renal cell carcinoma
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05231  Choline metabolism in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    443545 (PDGFB)
   04014 Ras signaling pathway
    443545 (PDGFB)
   04015 Rap1 signaling pathway
    443545 (PDGFB)
   04630 JAK-STAT signaling pathway
    443545 (PDGFB)
   04020 Calcium signaling pathway
    443545 (PDGFB)
   04072 Phospholipase D signaling pathway
    443545 (PDGFB)
   04151 PI3K-Akt signaling pathway
    443545 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    443545 (PDGFB)
   04540 Gap junction
    443545 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    443545 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    443545 (PDGFB)
   05206 MicroRNAs in cancer
    443545 (PDGFB)
   05231 Choline metabolism in cancer
    443545 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    443545 (PDGFB)
   05218 Melanoma
    443545 (PDGFB)
   05211 Renal cell carcinoma
    443545 (PDGFB)
   05215 Prostate cancer
    443545 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    443545 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    443545 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    443545 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    443545 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    443545 (PDGFB)
Cytokines and growth factors [BR:oas04052]
 Growth factors
  Growth factors (RTK binding)
   443545 (PDGFB)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   443545 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 443545
NCBI-ProteinID: NP_001009471
Ensembl: ENSOARG00000016412
UniProt: Q95229
LinkDB
Position
3
AA seq 241 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDSLDEDGAEL
DLNLTRSHSGGELESLSRGRRSLGSPTVAEPAVIAECKTRTEVSEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQDRKVQVKKIEIVRKKKIFKKATVTLVDHLACRC
ETVMARAVTRTPGSSQEQRAARTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggagaccccatccccgaggagctctacgagatgctgagtgaccactccatccgttcc
ttcgatgacctccagcgcctgctgcatggagactccttagatgaagacggagctgaattg
gacctgaacttgacccggtcccattctggaggcgagctcgagagcttatcccgtgggaga
aggagcctaggttccccaacggtcgccgagccagccgtgatcgcggagtgcaagacgcgc
acggaggtgtctgagatctcgcggcgcctcatagaccgcaccaacgctaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctctggctgctgcaacaaccgcaacgtgcag
tgccgccccacgcaggtgcaggatcggaaggtgcaggtgaaaaagattgagatcgtgcgg
aagaagaagatctttaagaaggccacagtgaccttggtggaccacctggcttgcaggtgt
gagacggtgatggctcgagccgtgacccgaaccccggggagttcccaggagcagcgagca
gccaggacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
gggaagcaccggaagttcaagcacacgcatgacaagacggcactgaaggagacccttgga
gcctag

DBGET integrated database retrieval system