KEGG   Ovis aries (sheep): 101106622
Entry
101106622         CDS       T03117                                 

Gene name
POLD3
Definition
(RefSeq) DNA polymerase delta subunit 3
  KO
K03504  DNA polymerase delta subunit 3
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03410  Base excision repair
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
oas03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101106622 (POLD3)
   03410 Base excision repair
    101106622 (POLD3)
   03420 Nucleotide excision repair
    101106622 (POLD3)
   03430 Mismatch repair
    101106622 (POLD3)
   03440 Homologous recombination
    101106622 (POLD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oas01009]
    101106622 (POLD3)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101106622 (POLD3)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101106622 (POLD3)
Protein phosphatases and associated proteins [BR:oas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101106622 (POLD3)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101106622 (POLD3)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101106622 (POLD3)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101106622 (POLD3)
SSDB
Motif
Pfam: CDC27
Other DBs
NCBI-GeneID: 101106622
NCBI-ProteinID: XP_004016369
Ensembl: ENSOARG00000010224
UniProt: W5PKJ6
LinkDB
Position
15
AA seq 464 aa
MADQFYLENIDEFVTDQNKIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVT
YLVSGSLIQNGHSCHKVAVVREDKLEAVKSKLAVTASVHVYSIQKAMLKDSGPLFNTDYD
ILKSNLQNCSKFSAIQCAAAVPRAPAEPSSSEKFEQSDPPVSPETQAGNELTTNGHGPPV
PRQSPQQPRGIMGMFASKAASKAQDASKEAKTEAKEVTNASSVGPKAPGKGNVISNFFGK
AAMNKLKVNLDSEQEVKEEKKVEQPPLSVTEPKLAAPVGLKKSSKKAEPVKMQQKEKKRR
KQAELSDDETKEPENVKKKRRRIKLPESDSSEDEVIPDSPGAYEAESPSPPPPSPSPEPV
LKTEPEPPPVKGSDGENKRKRKRVLKSKTFTDEEGCMVTEKVYESESCTDSEEELKMKTS
SVHRPPAMAVKKEPKEERKGPKKGTAAMGKANRQAAITGFFQRK
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcggaccagttttatctggaaaatatagacgagttcgtcacggaccagaacaagatc
gtaacatacaaatggctgagctatacactaggggttcatgttaatcaggccaaacagatg
ctctatgattacgttgaaaggaagcgaaaggaaaattcaggagcccaactgcatgtcacc
tatttagtgtctggcagtctcattcagaatggacattcttgccacaaggttgcagtagtg
agagaagataaattggaagcagtgaagtccaagctagcggtgactgccagcgtacatgtg
tacagcatccagaaagccatgctgaaggacagtgggcctctgttcaataccgactatgac
atccttaaaagcaacttgcagaactgcagcaagtttagtgccatccagtgtgcagctgcg
gtccctagagctcctgctgaaccctcatcttctgaaaagtttgagcagtcagatcctccg
gtgtcacctgagacgcaagccgggaacgagttgaccaccaatggtcatggcccacctgtc
cccagacagagtccccagcagcccagagggatcatgggcatgtttgcttctaaagctgct
tctaaagcccaagatgccagtaaggaagccaaaacagaggctaaagaagtaacgaatgca
tcttcagtaggccccaaggcaccagggaaggggaatgtcataagcaatttttttggaaaa
gctgctatgaataaacttaaagtcaatttggattcagaacaagaagtgaaagaagaaaaa
aaagtggagcaacctccactgtctgtcactgaaccaaagctggcagcccctgtgggcctg
aagaaatctagcaaaaaagcagagcctgttaagatgcaacagaaagaaaaaaaaaggagg
aagcaagcggagttatctgatgatgagacgaaagaacctgaaaacgtgaagaaaaagagg
aggagaatcaaacttcctgagtctgatagcagtgaagatgaagtcataccagactctcct
ggagcttatgaagctgagtcaccatccccacctcctccttctccttctcctgaaccagtg
ctgaagactgagccggagcctcctcctgtcaagggctccgatggagaaaacaaaagaaaa
cgaaaacgtgtgctgaaatctaaaacctttacagatgaggagggctgcatggtgactgag
aaagtctacgagagtgaatcctgcacagatagtgaagaagagcttaagatgaagacttcc
tctgtccataggcctcctgccatggctgtgaaaaaggaacccaaagaggaacgaaagggc
ccaaagaagggaactgctgctatgggcaaagccaacagacaagcggccattactggcttc
ttccagagaaagtga

KEGG   Ovis aries (sheep): 101117012
Entry
101117012         CDS       T03117                                 

Gene name
POLD1
Definition
(RefSeq) DNA polymerase delta catalytic subunit
  KO
K02327  DNA polymerase delta subunit 1 [EC:2.7.7.7]
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03410  Base excision repair
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
oas03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101117012 (POLD1)
   03410 Base excision repair
    101117012 (POLD1)
   03420 Nucleotide excision repair
    101117012 (POLD1)
   03430 Mismatch repair
    101117012 (POLD1)
   03440 Homologous recombination
    101117012 (POLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101117012 (POLD1)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101117012 (POLD1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     101117012 (POLD1)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101117012 (POLD1)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101117012 (POLD1)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101117012 (POLD1)
SSDB
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 zf-C4pol DNA_pol_B_2
Other DBs
NCBI-GeneID: 101117012
NCBI-ProteinID: XP_027833262
LinkDB
Position
14
AA seq 1106 aa
MDGKRRPGPGPGVPPKRARGGLWDEDEAYRPSQFEEELALMEEMEAERRLQEQEEEALQS
ALEGADGQFSLTASDARWLRPAPPPLDPQTEPLIFQQLEIDHYVGPARPLPGAPPPSQGS
VPILRAFGVTDEGVSVCCHIHGFAPYFYTPAPPGFGPEHLSELQRELSAAISRDQRGGKE
LTGPAVLAVELCSRESMFGYHGHGPSPFLRITLALPRLMAPARRLLEQGIRLAGLGTPSF
APYEANVDFEIRFMVDTDIVGCNWLELPAGKYILRPEGKATLCQLEADVLWSDVISHPPE
GEWQRIAPLRVLSFDIECAGRKGIFPEPERDPVIQICSLGLRWGEPEPFLRLALTLRPCA
PILGAKVQSYEREEDLLQAWSTFIRIMDPDVITGYNIQNFDLPYLISRAQTLKVPSFPLL
GRVIGLRSNIRDSSFQSRQTGRRDSKVVSMVGRVQMDMLQVLLREYKLRSYTLNAVSFHF
LGEQKEDVQHSIITDLQNGNDQTRRRLAVYCLKDAFLPLRLLERLMVLVNAMEMARVTGV
PLGYLLSRGQQVKVVSQLLRQAMRQGLLMPVVKTEGGEDYTGATVIEPLKGYYDVPIATL
DFSSLYPSIMMAHNLCYTTLLRPGAAQKLGLTEDQFIKTPTGDEFVKTSVRKGLLPQILE
NLLSARKRAKAELAKETDPLRRQVLDGRQLALKVSANSVYGFTGAQVGRLPCLEISQSVT
GFGRQMIEKTKQLVETKYTVENGYSTSAKVVYGDTDSVMCRFGVSSVAEAMALGREAADW
VSGHFPSPIRLEFEKVYFPYLLISKKRYAGLLFSSRPDAHDRMDCKGLEAVRRDNCPLVA
NLVTASLRRLLIDRDPAGAVAHAQDVISDLLCNRIDISQLVITKELTRAAADYAGKQAHV
ELAERMRKRDPGSAPSLGDRVPYVIISAAKGVAAYMKSEDPLFVLEHSLPIDTQYYLEQQ
LAKPLLRIFEPILGEGRAEAVLLRGDHTRCKTVLTGKVGGLLAFAKRRSCCVGCRTVLSH
QGAVCKFCQPRESELYQKEVSHLSALEERFSRLWTQCQRCQGSLHEDVICTSRDCPIFYM
RKKVRKDLEDQERLLRRFGPPGPEAW
NT seq 3321 nt   +upstreamnt  +downstreamnt
atggatggtaagcggcgaccaggcccggggcctggggtgcccccaaagcgggcccgcggg
ggcctctgggatgaggatgaggcgtaccggccctcgcagttcgaggaggagctggcgctg
atggaggagatggaagcagagcgcaggctgcaggagcaggaggaggaggcgctgcagtcg
gccctggagggggcggacgggcaattctccctgacggcctcagatgcccgctggcttcgg
cccgccccgccccccttggaccctcagacggagcccctcatcttccagcagttggagatc
gaccattatgtgggcccagcgcggcccctgcctggggcgcccccgccatcccagggctcg
gttcccatcctccgcgccttcggggtcaccgacgagggggtctctgtctgctgtcacatc
catggctttgcaccctacttctacaccccagcaccccccggtttcggacctgagcacctg
agtgagctgcagcgggaactgagtgcagccattagccgggaccagcgcgggggcaaggag
ctcactgggccggccgtgctggcagtggagctgtgctcccgggagagcatgtttgggtac
catgggcacggcccctccccgtttcttcgtatcaccctggcactgccccgcctcatggca
cccgcccgccgcctcctggagcaggggatccgcctggccggcctgggcacccccagcttt
gcgccctacgaggccaacgttgactttgagatccggttcatggtggacacggacatcgtg
ggctgcaactggctggagctcccagctgggaaatacatcctgaggccagaggggaaggcc
acgctgtgtcagctggaggccgacgtgctctggtcagacgtgatcagccacccgccggaa
ggagagtggcagcgaatcgcccctctgcgcgtgctcagcttcgacatcgagtgtgctggc
cgcaaaggcatcttcccggagcccgagcgggaccccgtgatccagatctgctcactgggc
ctgcgctggggcgagccggagcccttcctgcgcctggcactcaccctgcggccctgcgcc
cccatcctgggcgccaaggtgcagagctacgagcgggaggaggacctgctccaggcctgg
tcgaccttcatccgcatcatggatcccgacgtgattaccggctacaacatccagaacttt
gaccttccctacctcatctcccgggcccagaccctcaaggtgccaagcttccccttgctg
ggccgtgtgatcggcctccgctccaacatccgggactcgtccttccagtccaggcagacc
ggccggcgggacagcaaggtggtcagcatggtgggccgcgtgcagatggacatgctgcag
gtgcttctgcgggagtacaagctccggtcctacacgctcaatgccgtgagcttccacttc
ctgggcgagcagaaggaggacgtgcagcacagcatcatcacagacctgcagaacggaaac
gaccagacgcgccgccgcctggccgtgtactgcctcaaggacgccttcctgcccctgcgg
ctgctggagcggctcatggtgctggtgaacgccatggagatggcgcgtgtcaccggcgtg
cccctcggctacctgctcagccgcggccagcaggtcaaggtcgtgtcccagctgctgcga
caggccatgcgccaggggctgctgatgcccgtggtgaagacggagggcggtgaggactat
accggggccacggtcatcgagccactgaaagggtactatgacgtccccatcgccaccctg
gacttctcctcgctgtacccgtccatcatgatggcccacaacctgtgctacaccacgctc
ctgcggcccggggccgcccagaaactaggcctgaccgaggatcagttcatcaagacaccc
acgggggacgagtttgtgaagacatcggtgcggaaggggctgctcccccagatcctagaa
aacctgctcagcgcccggaagagggccaaggccgagctggccaaggagacagacccccta
cggcgacaagtgttggacgggcgccagctggcgctgaaagtgagtgctaactctgtgtac
ggcttcactggcgcccaggtgggtaggctgccgtgcctggaaatctcacagagcgtcacc
gggtttgggcgccagatgattgagaagacaaagcagctcgtggagaccaagtacacggtg
gagaacggctacagcaccagcgccaaggtggtgtatggtgacacagactcggtcatgtgc
cgcttcggcgtctcctccgtggctgaggcgatggctttgggacgggaggctgcagactgg
gtgtccggccacttcccctcgcccatccggctagagtttgagaaagtctacttcccctac
ctgctcatcagcaagaagcggtacgcgggcctgctcttctcctcccggcccgacgcccac
gaccgcatggactgcaagggcctggaggctgtgcgcagggacaactgccccctggtggcc
aacctcgtcaccgcctcgctgcgccgcctgctcatcgaccgagaccccgcgggcgccgtg
gcgcatgcacaggacgtcatctccgacctgctgtgtaatcgcattgacatctcgcagctg
gtcattaccaaggagctgacccgcgccgccgccgactacgcgggcaagcaggcccacgtg
gagctggccgagaggatgaggaagcgggaccccgggagcgcgcccagcctgggcgaccgc
gtcccctacgtgatcatcagcgctgccaagggcgtggccgcctacatgaagtccgaggac
cccctgttcgtactggagcacagcctgcccattgacacgcagtactacctggagcagcag
ctcgccaagccgctcctgcgcatcttcgagcccatcctgggcgagggccgtgcggaggct
gtgctgctgcgtggggaccacactcgctgcaagacggtgctcacgggcaaggtgggcggc
ctgctggccttcgccaaacgccggagctgctgcgttggctgccgcactgtcctcagccac
cagggagccgtgtgcaagttctgccagccccgggagtcggagctgtaccagaaggaggtg
tcccacctgagcgccctggaggagcgcttctcacgcctgtggacgcagtgccagcgctgc
cagggcagcctgcacgaggacgtcatctgcaccagccgggactgtcccatcttctacatg
cgcaagaaggtgcggaaggacctggaggaccaggagcggctgctgcggcgcttcgggccc
cccggccccgaggcctggtga

KEGG   Ovis aries (sheep): 101117838
Entry
101117838         CDS       T03117                                 

Gene name
POLD2
Definition
(RefSeq) DNA polymerase delta subunit 2 isoform X1
  KO
K02328  DNA polymerase delta subunit 2
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03410  Base excision repair
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
oas03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101117838 (POLD2)
   03410 Base excision repair
    101117838 (POLD2)
   03420 Nucleotide excision repair
    101117838 (POLD2)
   03430 Mismatch repair
    101117838 (POLD2)
   03440 Homologous recombination
    101117838 (POLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101117838 (POLD2)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101117838 (POLD2)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101117838 (POLD2)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101117838 (POLD2)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101117838 (POLD2)
SSDB
Motif
Pfam: DNA_pol_E_B DNA_pol_D_N
Other DBs
NCBI-GeneID: 101117838
NCBI-ProteinID: XP_027824530
Ensembl: ENSOARG00000016111
LinkDB
Position
4
AA seq 469 aa
MFSEQAAQRAHTLLSPPSASNATFARVPVVTYTNSSQPFRLGERSFSRQYAHIYATRLIQ
MRPFLVSRAQQCWGSGVLVKKLCELQPGEKCCVVGTLFKAMPLQPSILREVSEEHNLLPQ
PPRSKYIHPDDELILEDELQRIKLEGTIDVSKLVTGTVLAVLGSAGDDGKFLVEDHCFAG
LAPQKPTRPLDTDRFVLLVSGLGLGGGGGESLLGTQLLVDVVTGQLGDEGEQCSAAHVSR
VILAGNLLSHNTQSRDSINKAKYLTKKTQAASVEAVKMLDEILLQLSASVPVDVMPGEFD
PTNYTLPQQPLHPCMFPLATAYSTLQLVTNPYQATIDGVRFLGTSGQNVSDIFRYSSMED
HLEILEWTLQVRHISPTAPDTLGCYPFYKNDPFIFPECPHVYFCGNTPSFGSKIIQGPED
QTVLLVAVPDFSTTQTACLVNLRSLACQPISFSGFGAEDEDLGGLGLGP
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgttttctgagcaggctgcccagagggcccacactctgctgtccccgccatcagccagc
aatgccacttttgcccgggtgcctgttgtgacttacaccaactcctcgcagcccttccgg
ctgggagagcgcagctttagccgccagtatgcccacatttatgccacccgtctcatccag
atgaggcccttcctggtgagccgggcgcagcagtgctggggcagtggagtcctagtgaag
aagctgtgtgaactgcagcctggggagaagtgctgtgtggtggggaccctcttcaaggcc
atgccactccagccctccatcctacgggaggtcagcgaagagcacaacctgctcccccag
cctcctcggagcaaatatatccacccagatgatgaactgatcttggaagatgaattgcag
cgtatcaaactggaggggaccatcgacgtgtcaaagctggtcacaggaacggtcctggct
gtgctgggctctgcaggagatgatggaaagttcctggtagaggaccactgctttgcaggg
cttgcccctcagaagcctacacgccccctcgacacggacaggtttgtgctgctggtgtct
ggtctgggcctgggtggaggcgggggcgagagcctgctgggcacccagctgctggtggac
gtggtgacggggcagcttggggatgaaggagagcagtgcagtgccgcccacgtctcccgg
gtcatccttgccgggaacctcctcagccacaacacacagagcagagactccatcaacaag
gccaagtacttgaccaagaagacccaggccgccagcgtggaggccgtcaagatgctggac
gaaatcctcctgcagctgagcgcctccgtgcccgtggatgtgatgccgggcgaatttgac
ccaacaaactacacgctcccccagcagcccctgcacccctgcatgttccctctggccact
gcctactccacgctccagctggtcaccaacccctaccaggccactatcgatggagtcaga
ttcctggggacgtcaggacagaacgtgagtgacatcttccgatacagcagcatggaggac
cacttggagatcctggagtggacgctgcaagtccggcacatcagccccacagcccctgat
accctaggttgctaccctttctataaaaatgacccatttatctttccggagtgccctcac
gtctacttttgtggcaatacccccagctttggctccaaaatcatccaaggccccgaagac
cagacagtgttgttggtggctgtcccagacttcagcaccacccagaccgcctgtcttgtg
aacctgcgcagcctggcctgccagcccatcagcttctcaggctttggggcagaggatgag
gacctgggaggcctgggtctgggtccctga

KEGG   Ovis aries (sheep): 101118743
Entry
101118743         CDS       T03117                                 

Gene name
POLD4
Definition
(RefSeq) DNA polymerase delta subunit 4
  KO
K03505  DNA polymerase delta subunit 4
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03410  Base excision repair
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
oas03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101118743 (POLD4)
   03410 Base excision repair
    101118743 (POLD4)
   03420 Nucleotide excision repair
    101118743 (POLD4)
   03430 Mismatch repair
    101118743 (POLD4)
   03440 Homologous recombination
    101118743 (POLD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101118743 (POLD4)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101118743 (POLD4)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase delta complex
    101118743 (POLD4)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      101118743 (POLD4)
   MMR (mismatch excision repair)
    DNA polymerase delta complex
     101118743 (POLD4)
SSDB
Motif
Pfam: DNA_pol_delta_4
Other DBs
NCBI-GeneID: 101118743
NCBI-ProteinID: XP_004019763
Ensembl: ENSOARG00000010956
LinkDB
Position
21
AA seq 107 aa
MGRKRLITDSYPVVKRREGSAGHSKGELAPELGEEPLTLSVDEAELELLRQFDLAWQYGP
CTGITRLQRWHRAEQMGLKPPPEVRQVLQSHPGDPRFQCSLWHFYPL
NT seq 324 nt   +upstreamnt  +downstreamnt
atgggccggaaacggctcatcactgactcctaccctgtagtgaagaggagggagggctcc
gctgggcacagcaagggggagctggcaccagagctaggggaagagcccctaaccctgagc
gtggatgaagcggagctggagctgctgaggcagtttgacctggcctggcagtatgggccc
tgcacagggatcacacggttgcagcgctggcatcgggcagagcagatgggcttgaagcct
cccccagaagtgcgtcaggtgctgcagagccaccccggggatccccgcttccagtgcagc
ctctggcatttctatcccctctga

DBGET integrated database retrieval system