KEGG   Ovis aries (sheep): 101107124
Entry
101107124         CDS       T03117                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
oas  Ovis aries (sheep)
Pathway
oas04110  Cell cycle
oas04114  Oocyte meiosis
oas04115  p53 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04218  Cellular senescence
oas04934  Cushing syndrome
oas05161  Hepatitis B
oas05162  Measles
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05206  MicroRNAs in cancer
oas05215  Prostate cancer
oas05222  Small cell lung cancer
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101107124 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101107124 (CCNE1)
   04114 Oocyte meiosis
    101107124 (CCNE1)
   04115 p53 signaling pathway
    101107124 (CCNE1)
   04218 Cellular senescence
    101107124 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101107124 (CCNE1)
   05206 MicroRNAs in cancer
    101107124 (CCNE1)
   05203 Viral carcinogenesis
    101107124 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101107124 (CCNE1)
   05215 Prostate cancer
    101107124 (CCNE1)
   05222 Small cell lung cancer
    101107124 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101107124 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101107124 (CCNE1)
   05161 Hepatitis B
    101107124 (CCNE1)
   05162 Measles
    101107124 (CCNE1)
   05169 Epstein-Barr virus infection
    101107124 (CCNE1)
   05165 Human papillomavirus infection
    101107124 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101107124 (CCNE1)
   03036 Chromosome and associated proteins [BR:oas03036]
    101107124 (CCNE1)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101107124 (CCNE1)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101107124 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C CBM_1
Other DBs
NCBI-GeneID: 101107124
NCBI-ProteinID: XP_014956028
Ensembl: ENSOARG00000004067
UniProt: A0A6P3YMJ0 W5P1P9
LinkDB
Position
14
AA seq 411 aa
MPREKERDAKEPDTMKEESGTDVSVRSRKRKANVAVFLQDPDEEIAKIDKTVRSQCGSQP
WDSNTACENPCSLIPTPDKEEDELLYPHAAYKPQRCTPSSSRASPLPVLNWANREEVWKI
MLNKEKTYLRDKHLMQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMAT
QQNVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELIIMKALKW
HLSPLTIVSWLNVYMQVAYLNDFYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFSYGVL
AASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAIVIRETGSSKLKHFRGVPAEDAHN
IQTHINSLDLLDKAQAKKAILSEENRISPLPTGVLTPPQSSKKQSSGQGSA
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgccgagggaaaaggagagggatgcgaaggaaccggataccatgaaagaggaaagtggc
accgatgtctctgttcgctccaggaaaagaaaggcaaatgtagccgtttttttgcaggat
ccagatgaagaaattgccaaaattgacaagactgtgagaagccagtgtggcagtcagcct
tgggacagtaatacagcctgtgaaaacccctgctccctgattcccacacctgacaaagaa
gaggatgaacttctgtacccacacgctgcgtacaagcctcagaggtgcacgccatcgtca
tccagagcgtcgccactgcctgtactgaactgggcaaatagagaggaagtatggaaaatc
atgttaaacaaggagaagacatacttgagggacaagcatcttatgcaacggcaccctctt
ctgcagcctaaaatgcgagcaattcttctggattggttaatggaggtatgtgaagtctat
aaacttcacagagagacattttacttggcacaggatttctttgatcggtatatggcaaca
caacaaaatgttgtaaaaacacttttacagcttattgggatttcatctttatttattgct
gccaaacttgaggaaatctatcctccaaagttgcaccagtttgcttatgttacagatggg
gcttgttcaggagatgaaattctcaccatggaattaatcatcatgaaggcccttaagtgg
catttaagtcccctgaccattgtgtcctggttgaatgtatacatgcaggttgcatatcta
aatgatttttatgaagtgctcctgcctcagtatcctcagcaaatcttcatacagattgca
gagcttttagatctctgtgtcctggatgtcggctgcttagaattctcttatggtgtactt
gctgcttccgccttgtatcatttctcttcatccgaactgatgcaaaaggtttcagggtat
cagtggtgtgatatagagaagtgtgtcaagtggatggttccatttgccatagttataagg
gagacaggaagttcaaaacttaagcacttcaggggagttcctgctgaagatgcgcacaac
atccagacccatataaacagcttggatttgctggacaaagcccaagcaaagaaagccata
ttatctgaagaaaacaggatttctcctctccccactggagtcctcaccccgccacagagc
agtaagaagcagagcagtgggcagggatcagcatga

KEGG   Ovis aries (sheep): 101109811
Entry
101109811         CDS       T03117                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2
  KO
K06626  G1/S-specific cyclin-E1
Organism
oas  Ovis aries (sheep)
Pathway
oas04110  Cell cycle
oas04114  Oocyte meiosis
oas04115  p53 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04218  Cellular senescence
oas04934  Cushing syndrome
oas05161  Hepatitis B
oas05162  Measles
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05169  Epstein-Barr virus infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05206  MicroRNAs in cancer
oas05215  Prostate cancer
oas05222  Small cell lung cancer
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101109811 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101109811 (CCNE2)
   04114 Oocyte meiosis
    101109811 (CCNE2)
   04115 p53 signaling pathway
    101109811 (CCNE2)
   04218 Cellular senescence
    101109811 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101109811 (CCNE2)
   05206 MicroRNAs in cancer
    101109811 (CCNE2)
   05203 Viral carcinogenesis
    101109811 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    101109811 (CCNE2)
   05215 Prostate cancer
    101109811 (CCNE2)
   05222 Small cell lung cancer
    101109811 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101109811 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101109811 (CCNE2)
   05161 Hepatitis B
    101109811 (CCNE2)
   05162 Measles
    101109811 (CCNE2)
   05169 Epstein-Barr virus infection
    101109811 (CCNE2)
   05165 Human papillomavirus infection
    101109811 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101109811 (CCNE2)
   03036 Chromosome and associated proteins [BR:oas03036]
    101109811 (CCNE2)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    101109811 (CCNE2)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    101109811 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101109811
NCBI-ProteinID: XP_012039495
Ensembl: ENSOARG00000006180
UniProt: A0A6P3TVS8 W5P865
LinkDB
Position
9
AA seq 404 aa
MSRRSSRLQAKQQPQASQTDSPQEAQIIQAKKRKTAQDVKKRKEEVTKKHQYEIRNCWPP
VLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWGCSQDVWLNMLKK
ETRYVHDKHFEVLHSELEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDI
NKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELAILKALKWELCP
VTVISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAIDSLEFQYRILAAAA
LCHFTSIEVVKKASGLEWDNISECVDWMVPFVSVVKSTSPAKLKIFKKISMEDRHNIQTH
TNYLAMLDEVNYVNTFRKEGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1215 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaaacagcagccccaggccagtcagacggat
tccccgcaagaagcccagataattcaggccaagaagaggaaaacggcccaggatgtcaaa
aaaagaaaagaggaggtcaccaagaaacatcagtatgaaataaggaattgttggccacct
gtattatccggggggatcagtccttgcattatcattgaaacaccccacaaagaaatagga
acaagtgacttctccagatttacaaactacagatttaaaaatctttttattaatccttca
cctttacctgatttaagctggggatgttcacaagatgtttggctaaacatgttaaaaaaa
gagaccagatatgttcacgacaaacattttgaagttctgcattctgagttggaaccacag
atgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcatagg
gaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggatata
aataaaaatatgcttcaactgattggaattacctcattattcattgcttccaaacttgag
gaaatctacgctcctaagctccaagagtttgcttatgtcactgatggtgcttgcagtgaa
gaggatatcttaaggatggaacttgctatattaaaggctttaaaatgggaactttgtcct
gtaacggtcatctcctggctaaatcttttcctccaagttgatgctcttaaagatgctcct
aaagttcttctacctcagtattctcaggaaaagttcattcaaattgctcagcttctagat
ttgtgtattttagccattgattcattagagttccagtacagaatactggctgctgctgcc
ttgtgccactttacctctattgaagtggttaagaaagcctcaggtttggaatgggacaac
atttctgaatgtgtagactggatggtaccttttgtcagtgtagtaaaaagtactagccca
gcaaagcttaagatttttaagaagatttctatggaagacagacacaacatacagacacat
acaaattatctggctatgctggatgaagtaaattatgtaaacaccttcagaaaggaggga
cagttgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcactgaaaaacca
ccaggaaaacactaa

DBGET integrated database retrieval system