KEGG   Ovis aries (sheep): 101107332
Entry
101107332         CDS       T03117                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
oas  Ovis aries (sheep)
Pathway
oas01523  Antifolate resistance
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04062  Chemokine signaling pathway
oas04064  NF-kappa B signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04380  Osteoclast differentiation
oas04620  Toll-like receptor signaling pathway
oas04621  NOD-like receptor signaling pathway
oas04622  RIG-I-like receptor signaling pathway
oas04623  Cytosolic DNA-sensing pathway
oas04625  C-type lectin receptor signaling pathway
oas04657  IL-17 signaling pathway
oas04658  Th1 and Th2 cell differentiation
oas04659  Th17 cell differentiation
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04668  TNF signaling pathway
oas04920  Adipocytokine signaling pathway
oas05132  Salmonella infection
oas05135  Yersinia infection
oas05142  Chagas disease
oas05145  Toxoplasmosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05212  Pancreatic cancer
oas05215  Prostate cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05340  Primary immunodeficiency
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101107332 (IKBKG)
   04014 Ras signaling pathway
    101107332 (IKBKG)
   04064 NF-kappa B signaling pathway
    101107332 (IKBKG)
   04668 TNF signaling pathway
    101107332 (IKBKG)
   04151 PI3K-Akt signaling pathway
    101107332 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101107332 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101107332 (IKBKG)
   04621 NOD-like receptor signaling pathway
    101107332 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    101107332 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    101107332 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    101107332 (IKBKG)
   04660 T cell receptor signaling pathway
    101107332 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    101107332 (IKBKG)
   04659 Th17 cell differentiation
    101107332 (IKBKG)
   04657 IL-17 signaling pathway
    101107332 (IKBKG)
   04662 B cell receptor signaling pathway
    101107332 (IKBKG)
   04062 Chemokine signaling pathway
    101107332 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101107332 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101107332 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101107332 (IKBKG)
   05203 Viral carcinogenesis
    101107332 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101107332 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101107332 (IKBKG)
   05221 Acute myeloid leukemia
    101107332 (IKBKG)
   05220 Chronic myeloid leukemia
    101107332 (IKBKG)
   05215 Prostate cancer
    101107332 (IKBKG)
   05222 Small cell lung cancer
    101107332 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    101107332 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101107332 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101107332 (IKBKG)
   05135 Yersinia infection
    101107332 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101107332 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    101107332 (IKBKG)
   05162 Measles
    101107332 (IKBKG)
   05164 Influenza A
    101107332 (IKBKG)
   05161 Hepatitis B
    101107332 (IKBKG)
   05160 Hepatitis C
    101107332 (IKBKG)
   05168 Herpes simplex virus 1 infection
    101107332 (IKBKG)
   05163 Human cytomegalovirus infection
    101107332 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101107332 (IKBKG)
   05169 Epstein-Barr virus infection
    101107332 (IKBKG)
   05165 Human papillomavirus infection
    101107332 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101107332 (IKBKG)
   05142 Chagas disease
    101107332 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    101107332 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101107332 (IKBKG)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   101107332 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 ZapB LLC1 zf_C2H2_ZHX
Other DBs
NCBI-GeneID: 101107332
NCBI-ProteinID: XP_027819130
Ensembl: ENSOARG00000004058
LinkDB
Position
X
AA seq 407 aa
MVQPSGGPAGDQDMLGEESSLGKPAMLHMPSEQGTPETFQRCLEENQELRDAIRQSNQML
RERCEELQRFQGNQREEKAFLMQKFQEARDLVARLSLEKRELRQQREQALQEVERLKTCQ
QQMAEDKASVKAQVTSLLGELQESQSRLEAATKERQALESRARVASEQARQLESEREALQ
QRHSVQVDQLRLQNQNMEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDSHIKSSMVSS
ERNRGLQLEDLKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADF
QAERQAREKLAEKKEFLQEQLEQLQREYSRLKTSCQESARIEDMRKRHVEVSQPPLTPAP
AHHSFNLALPIQRRSPPDEPPNFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1224 nt   +upstreamnt  +downstreamnt
atggtgcagccgagtggtggcccggcaggggaccaggacatgctaggtgaagagtcttct
ctggggaagccagccatgctccacatgccttcagagcagggcacccctgagaccttccag
cgctgtctggaggagaatcaagagctccgagacgccatccgccagagcaaccagatgctg
cgcgagcgctgtgaggagctgcagcgtttccagggcaaccagagggaggagaaggccttc
ctcatgcagaagttccaggaggcccgggacttggtggcgaggctgagcctagagaagcgc
gaactgcgccagcagagggagcaggccctacaggaggtggaacgcctgaagacatgccag
cagcagatggctgaggacaaggcctcagtgaaagcccaggtaacatccttgctgggggag
ctgcaggagagccagagtcgcttggaggctgccactaaggagcgccaggctttggagagc
agggcccgggtggccagtgaacaggcccggcagctggagagcgagcgggaggcgctgcaa
cagcggcatagcgtgcaggtggaccagctgcgtctgcagaaccagaacatggaggctgcc
ctgcgcatggaacgccaggctgcctcggaggagaagcggaagctggcccagctgcaggtg
gcttatcaccagctcttccaagagtatgacagccacatcaagagcagcatggtgagcagt
gagcggaaccgaggactgcagctggaggatctcaagcagcagctccagcaggctgaggag
gccctggtggccaaacaggaagtgatcgacaagctgaaggaggaggcggaacagcacaag
attgtgatggagactgtcccagtgctgaaagcccaggcggatatctacaaggcagacttc
caggctgagaggcaggcccgggagaagctggctgagaagaaggaattcctgcaagaacag
ctggagcagctgcagagggaatatagcaggttgaagaccagctgtcaggagtcagccagg
attgaagacatgaggaagcggcacgttgaggtctcccagccccccttaacacctgcccca
gctcatcactcctttaacctggccctgcccatccagaggagaagcccccctgacgagccg
cccaacttctgctgccccaagtgtcagtatcaggctcctgacatggacaccctgcagata
cacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system