KEGG   Ovis aries (sheep): 101107426
Entry
101107426         CDS       T03117                                 

Gene name
MSH6
Definition
(RefSeq) DNA mismatch repair protein Msh6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
oas  Ovis aries (sheep)
Pathway
oas01524  Platinum drug resistance
oas03430  Mismatch repair
oas05200  Pathways in cancer
oas05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101107426 (MSH6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101107426 (MSH6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101107426 (MSH6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101107426 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101107426 (MSH6)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     101107426 (MSH6)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II
Other DBs
NCBI-GeneID: 101107426
NCBI-ProteinID: XP_012027333
Ensembl: ENSOARG00000005046
LinkDB
Position
3
AA seq 1361 aa
MSRQSTLYSFFPKSPAVNNANKASVRASSGSSAAAAATGASPSPGGDAAWNEAGPEPLAG
TTSRAEARNLNGGLRKSASPAIPASSSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI
REKGKSARVHVQFFDDSPTRGWVSRRLLKPYTGSHSKEAQKGGHFYSAKPEIHRAMQRAD
EALNKDKIKRLELAVCDEPSEPEEEEETEVGATYTSDKSEEENDIESEEEVRPKVQGSRR
SSRQIKKRRVISDSESDIGGSDVEFKPDTKEEASSDEISSGMGDSDSEGLDTPVKVAPKR
KRMVTGNGSLKRKSSRKEMPSATKRATGISSEIKNTLSAFSVPQNPESQAHISGGCDDSN
RPTVWYHETLEWLKEEKRRDVHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQN
FDLVIFYKVGKFYEMYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKV
ARVEQTETPDMMEARCRKMAHTSKYDRVVMREICRVITKGTQTYSVLEGDPSENYSKYLL
SLKEKEEESSGHTRVYGVCFVDTSLGRFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGN
LSTETKMILKSSLSSSLQEGLIPGSQFWDAAKTLRTLLEEGYFTDKLNEDGGVMLPQVLK
GMTAESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYVPLDSDMVHAT
RPGAVFTKANQRMVLDAVTLSNLEIFLNGTNGSTEGTLLEKIDTCHTPFGKRLLKQWLCA
PLCNPHAINDRLDAIEDLMVVPDKISEVVDLLKKLPDLERLLSKIHNVGSPLKSQNHPDS
RAIMYEETTYSKKKIIDFLSALEGFKVICKVIGVMEEVIDDFKSKILKQVLTLQTKNPEG
RFPDLTSELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRS
RIGCRTIVYWGIGRNRYQLEIPENFITRNLPEEYELKSTKKGCKRYWTKTIEKKLADLIK
AEERRDTSLKDCMRRLFYNFDKNYKDWQAAVECIAVLDVLLCLTNYSRGGDGPMCRPIIL
LPEEDTPPFLDLKGSRHPCITKTFFGDDFIPNDILIGCEEEEEENGKAYCVLVTGPNMGG
KSTLMRQAGLLAIMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETAS
ILTHATAHSLVLVDELGRGTATFDGTAIANAVVKELAENIKCRTLFSTHYHSLVEDYSQN
IAVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRK
AREFEKMTQSLRLFREVCLASERSTVDADAVHKLLTLIEEL
NT seq 4086 nt   +upstreamnt  +downstreamnt
atgtcgcgacagagcacgctgtatagcttcttccctaaatctccagccgtgaataatgcc
aacaaagcctccgtcagagcctcaagtggaagcagcgccgccgccgctgccaccggggcc
tccccttccccaggcggggatgcggcctggaacgaggccgggcctgagcccctagcgggt
accacgtcgcgggccgaggccaggaacctcaacggagggctgcggaagtcggcatcccct
gcgatccccgccagcagttcttgtgacttctcaccaggtgatttggtttgggccaagatg
gagggttacccttggtggccttgcctggtttacaaccacccttttgatggaacattcatc
cgtgagaaaggaaagtctgcccgagttcatgtacagttttttgatgacagcccaactcgg
ggctgggttagcagaaggctattaaagccatatacaggttcacattcaaaggaagcccag
aaaggaggtcatttttacagtgcaaagcctgaaatacacagagcaatgcaacgtgcagat
gaagccttgaataaagacaagattaagaggcttgagttggcagtgtgtgatgagccctca
gagccagaggaggaagaagagacagaggtaggtgccacttacacatcagataagagtgaa
gaggaaaatgacattgagagtgaagaggaagtgaggccgaaggtgcaaggatccagacga
agtagccgacaaataaaaaaacgaagggtcatatcagactctgagagtgacattggtggc
tctgatgtggaattcaagccagacactaaggaggaagcaagcagtgatgaaataagcagt
ggcatgggggacagtgatagtgaaggcctggacacccctgtcaaagttgctccaaagcgg
aagagaatggtaactgggaatggttctctcaagaggaagagttcaagaaaggaaatgcct
tcagccaccaaacgagcaactggcatttcatcagaaatcaagaatactttgagtgctttc
tctgtccctcaaaatcctgaatctcaagcccacattagtgggggatgtgatgacagtaat
cgccccactgtctggtatcatgaaactttagagtggcttaaggaggaaaagagaagagat
gtgcacaggaggcggcccgatcacccagattttgatgcatccacactctatgtgcccgag
gatttccttaattcctgtactcctgggatgaggaagtggtggcaaattaagtctcagaac
tttgatctggtcatattttataaagtggggaagttttatgagatgtaccacatggatgct
cttattggagtcagtgaactagggctggtattcatgaaaggaaactgggcccattctggt
ttccctgaaattgcatttggccgatactcagattccctggtccagaagggctataaagta
gcgcgagtagaacagactgagaccccagacatgatggaggcacgatgccgaaagatggca
cacacatctaagtatgacagagtggtgatgagggagatctgtagggtcattaccaagggc
acacagacctacagtgtgctggagggtgacccctcggagaattacagtaagtaccttctc
agcctcaaagagaaagaagaggagtcttctggccacactcgcgtgtatggagtatgcttt
gttgatacctcactagggaggttcttcataggtcagttttcagacgatcgccattgttcc
aggtttaggactttagtggcacactatcctccagtacaagtcttatttgagaagggaaat
ctctcaacagaaacaaagatgattctcaagagttcattatcctcttctcttcaggaaggt
ctgataccgggctcccagttttgggatgcagccaaaactttgagaactctccttgaagaa
ggatattttacggacaagttaaatgaggacggtggggtgatgctaccccaggtgcttaaa
ggtatgactgcagagtcagattctattggattgacaccaggagagaagagtgaattggcc
ctctctgctcttggtggttgtgtcttctacctcaaaaaatgccttattgatcaggagctt
ttatcaatggctaattttgaagaatatgttcccttggattctgacatggtccatgctaca
agacctggtgctgtctttactaaagccaatcaacgaatggtgctagatgctgtgacatta
agcaacttggagatttttctgaatggaacaaatggttctactgaagggaccttgttagag
aagattgatacttgccatactccctttggtaaacggctcttaaagcagtggctttgtgcc
ccactctgtaaccctcatgcgatcaatgatcgcctggatgccatagaggacctaatggtt
gtgcctgacaaaatctctgaggttgtagaccttcttaagaagcttccagaccttgagaga
ctactgagtaaaattcataatgttgggtctccccttaagagccagaaccacccagacagc
agggctataatgtatgaagaaaccacatacagcaaaaaaaagattattgattttctttct
gctctggaaggattcaaagtaatatgtaaagttataggggttatggaagaggtcattgat
gactttaagtctaaaatcctcaagcaggtccttactctgcagacaaaaaatcctgaaggg
cgctttcctgatttgacttcagaactgaaccgatgggatacagcctttgaccatgaaaag
gctcgaaagactggactgattactcccaaagcaggatttgactctgattatgaccaagct
cttgctgacataagagaaaatgaacagagcctcctggaatacttggagaaacagcgcagt
cgaattggctgtagaaccatagtttactggggaattggtaggaatcgttaccagttggaa
attccagagaatttcatcacccgtaatttaccagaagaatatgagttgaaatccaccaaa
aagggttgtaaacgatactggaccaaaacaattgagaagaagttggctgatctgataaaa
gccgaagaacggagagacacatcattaaaggactgcatgaggcgactattctataacttt
gataaaaattacaaggactggcaggctgctgtggagtgcatcgcagttttggatgtgtta
ttgtgcctgactaactacagtcgagggggtgatggtcctatgtgtcgtccaataattctg
ttgccagaagaagatactcctccctttctagaccttaaaggatcacgccatccctgcatt
acgaagactttttttggtgatgactttattcctaatgacattctaataggctgtgaggaa
gaggaggaggaaaatggcaaagcttattgtgtgcttgttactggaccaaatatgggaggg
aagtctacacttatgagacaggctggcctattagctataatggcccagatgggctgttac
gtaccagctgaagtgtgtaggctcacaccaattgatagagtgtttactagacttggtgcc
tcagacagaataatgtcaggtgaaagtacattttttgttgaattgagtgaaactgccagt
atacttacacatgcaacagcacactctctggtgcttgtggatgaattaggaagaggcacc
gcaacattcgatgggacagcaatagcaaacgcagttgtcaaagagcttgctgagaatata
aagtgccgtacattgttttctacccactatcattcattagttgaagattattctcaaaat
attgcagtgcgcctaggacacatggcatgcatggtagaaaatgaatgtgaagatcccagc
caggagactattaccttcctctacaaattcattaaaggagcctgtcctaaaagctatggc
tttaatgcagcaaggcttgctaatcttccagaggaggttattcaaaagggacatagaaaa
gcaagagaatttgagaagatgactcagtcactgcgattatttcgggaggtttgtctggct
agtgaaaggtctactgtggatgctgatgctgtccataagttgctgactttgattgaggaa
ttatag

DBGET integrated database retrieval system