KEGG   Ovis aries (sheep): 101107715Help
Entry
101107715         CDS       T03117                                 

Gene name
ADORA2B
Definition
(RefSeq) adenosine receptor A2b
  KO
K04267  adenosine receptor A2b
Organism
oas  Ovis aries (sheep)
Pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04270  Vascular smooth muscle contraction
oas05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101107715 (ADORA2B)
   04020 Calcium signaling pathway
    101107715 (ADORA2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101107715 (ADORA2B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101107715 (ADORA2B)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    101107715 (ADORA2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101107715 (ADORA2B)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    101107715 (ADORA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx GPR_Gpa2_C
Motif
Other DBs
NCBI-GeneID: 101107715
NCBI-ProteinID: XP_027830624
LinkDB All DBs
Position
11
AA seq 332 aa AA seqDB search
MPLEAQDAVYVALELALAALSVTGNVLVCAAVGTSTVLQTPTNYFLVSLAAADVAVGLFA
IPFAVTISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAVDRYLAVRVPLRYKSLVTGA
RARGVIAALWGLAFGIGLTPFLGWNSRKSAINCTEPGDGAANVTCCLIRCLFENVVPMSY
MVYFNFFGCVLPPLLIMLVIYVKIFLVACRQLQRTELMDHSRTVLQREIHAAKSLAMIVG
IFALCWLPVHAINCASLFQPTWAKEKPKWAMNIAILLSHANSAVNPIVYAYRNRDFRYTF
HKIISRYILCQTDVFKSGEGQVGSQPTLQLGL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggaggcgcaggacgcggtgtacgtggcgctggagctggcgctggccgcgctg
tcggtgaccggcaacgtgctggtgtgcgcggcggtgggcacctcgaccgtgctgcagacg
cccaccaactactttttggtgtcgctggccgcggccgacgtggccgtggggctgttcgcc
atccccttcgccgtcactatcagcctgggcttctgcaccgacttccacagctgcctcttc
ctcgcctgtttcgttctcgtgctcacgcagagctccatcttcagcctcctggccgtggcc
gtcgacagatacctggccgtgcgcgtcccgctcaggtataagagtctggtcactggggct
cgagcgagaggagtcatagctgccctctggggcctggcctttggcattggcttgacacca
ttcttggggtggaacagcagaaaaagtgccatcaactgcacggagccgggggatggagcc
gcgaacgtgacctgctgcctcatcaggtgtctcttcgaaaacgtggtgcccatgagctac
atggtgtacttcaacttttttggctgcgtcctgcccccactgctcatcatgctggtcatc
tatgtcaagatcttcctggtggcctgcaggcagctacagcgcacagagctcatggaccac
tcaaggaccgtcctccagcgggagatccacgcggccaagtccctggccatgattgttggc
atctttgccctgtgctggctgccggtccacgccatcaactgcgcctcgctcttccagcca
acctgggccaaggagaagcccaagtgggcgatgaacatagccatcctcctgtcgcacgcc
aactcggctgtcaaccccatcgtctacgcctaccggaaccgagacttccgctacactttt
cacaaaatcatttccaggtacatcctctgccagacggatgtcttcaagagtggggagggg
caggtggggtcgcagcccactctccagctgggcctatga

KEGG   Ovis aries (sheep): 101109816Help
Entry
101109816         CDS       T03117                                 

Gene name
ADORA1
Definition
(RefSeq) adenosine receptor A1
  KO
K04265  adenosine receptor A1
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04071  Sphingolipid signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04923  Regulation of lipolysis in adipocytes
oas04924  Renin secretion
oas05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    101109816 (ADORA1)
   04024 cAMP signaling pathway
    101109816 (ADORA1)
   04022 cGMP-PKG signaling pathway
    101109816 (ADORA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101109816 (ADORA1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101109816 (ADORA1)
   04924 Renin secretion
    101109816 (ADORA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    101109816 (ADORA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101109816 (ADORA1)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    101109816 (ADORA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx CcmH UCR_Fe-S_N
Motif
Other DBs
NCBI-GeneID: 101109816
NCBI-ProteinID: XP_027831981
LinkDB All DBs
Position
12
AA seq 326 aa AA seqDB search
MPPSISAFQAAYIGIEVLIALVSIPGNVLVIWAVKVNQALRDATFCFIASLAVADVAVGA
LVIPLAILINIGPRTSFHTCLKVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLRAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCVTLFCPSCRMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPVDEDPPAERPDD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctccatctcagccttccaggctgcgtatattggcatcgaggtgctcatcgcc
ctggtctctatacctgggaacgtgctggtgatctgggcggtgaaggtgaatcaggccttg
cgggatgccaccttctgcttcatcgcgtcactggctgtggctgatgtggcggtgggcgcg
ctggtcatcccgctcgccatcctcatcaacattgggccgcggacctccttccacacctgc
ctcaaggtcgcctgccctgtcctcatcctcactcagagctccatcctggccctgctggca
attgctgttgaccgctacctccgtgtcaagatcccactgaggtacaagacagtggtgact
cctcgaagggctgtggtggccatcactggctgctggattctctcctttgtggtgggcctg
acgcccatgttcggctggaacaacctgagagccgtcgagcgggactggctggccaacggc
agcgtgggcgagcctgtgattgagtgccagttcgagaaggtcatcagcatggagtacatg
gtctacttcaacttcttcgtgtgggtgctgcccccgctgctgctcatggtcctcatctac
atggaggtcttctatctgatccgcaagcagctcaacaagaaggtgtcggcctcctccgga
gacccacagaagtactacgggaaggagctgaagatcgccaagtcactggccctcatcctc
ttcctcttcgcccttagctggctgcccttgcacatcctcaactgcgtcaccctcttctgc
ccttcctgccgcatgcccaggatcctcatatacatcgccatcttcctctcgcatggcaac
tcggccatgaaccccatcgtctacgccttccgcatccagaagtttcgagtgaccttcctt
aagatctggaatgaccacttccgctgccaacctgcgccccccgttgatgaggatccccca
gcagagaggcctgatgactag

KEGG   Ovis aries (sheep): 101112926Help
Entry
101112926         CDS       T03117                                 

Gene name
ADORA2A
Definition
(RefSeq) adenosine receptor A2a
  KO
K04266  adenosine receptor A2a
Organism
oas  Ovis aries (sheep)
Pathway
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04270  Vascular smooth muscle contraction
oas05012  Parkinson disease
oas05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101112926 (ADORA2A)
   04020 Calcium signaling pathway
    101112926 (ADORA2A)
   04024 cAMP signaling pathway
    101112926 (ADORA2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101112926 (ADORA2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101112926 (ADORA2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101112926 (ADORA2A)
  09165 Substance dependence
   05034 Alcoholism
    101112926 (ADORA2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    101112926 (ADORA2A)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    101112926 (ADORA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 101112926
NCBI-ProteinID: XP_014956928
LinkDB All DBs
Position
17
AA seq 390 aa AA seqDB search
MDGFSAYIAVELAIAVLAILGNVLVCWAVWLNSNLQSVTNYFVASLAAADIAVGVLAIPF
AVTLSTGFCAACHSCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGSRAK
GIIAVCWVLSFVIGLTPMLGWNNCSQQEGRNSSRACGQGRVACLFEDVVPMGYMVYYNFF
ACVQLPLLLMLGVYLRIFLAARRQLKQTEGQPAPPGERARSTLQKEVHAAKSLAIIVGLF
ALCWLPLHVVNCFTFFCPSCRHAPPWLMYLTIVLSHGNSVVNPFIYAYRIREFRHTFRRI
LRSHVLRRRRRREPFKAGGPGARALAAPDTERVGLRLNGHPPGGAWANGSAARPDGPALA
LPSALPDAQLQGRRPESPGPGGPRAGAGVS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggacggcttctcggcgtacatcgcggtggagctggccatcgccgtgctggccatccta
ggcaacgtgctggtgtgctgggccgtgtggctcaacagcaacctgcagagcgtcaccaac
tacttcgtggcctcgctggcggcggccgacatcgccgtgggggtgctcgccatccccttc
gccgtgaccctgagcaccggcttctgcgcggcctgccacagctgcctgttcttcgcctgc
ttcgtcctggtgctcacgcagagctccatcttcagcctgctggccatcgccattgaccgc
tacatcgccatccggatcccgctccggtacaacggcttggtgactggctcgcgggccaag
ggcatcatcgccgtctgctgggtgctgtccttcgtcatcggcctgacccccatgctgggc
tggaacaactgcagccagcaggagggccggaacagctcgcgggcctgcgggcagggccgg
gtggcctgcctcttcgaggacgtggtgcccatgggctacatggtgtactacaacttcttt
gcttgcgtgcagctgccgctgctgctcatgctcggcgtctacctgcgcatcttcctggcg
gcgcggcggcagctgaagcagacggagggccagccggcgccgccgggggagcgcgcgcgc
tccacgctgcagaaagaggtgcacgccgccaagtcgctcgccatcatcgtggggctgttc
gcgctgtgctggctgccgctgcacgtcgtcaactgcttcaccttcttctgcccctcgtgc
cgccacgccccgccctggctcatgtacctgaccatcgtcctctcgcacggcaactcggtg
gtgaacccgttcatctacgcctaccgcatccgcgagttccgccacaccttccgcaggatc
ctgcgcagccacgtgctgcggcggcggcggcggcgcgagcccttcaaggcggggggcccc
ggcgcccgcgccctggcggcccccgacacggagcgcgtgggcctccgcctcaacggccac
ccgcccgggggcgcctgggccaacggcagcgccgcccggcccgacggccccgccctggcg
ctgcccagcgccctcccggacgcgcagctccagggccggcgcccagagtccccgggcccc
gggggcccccgggccggggcaggagtgtcctga

KEGG   Ovis aries (sheep): 443330Help
Entry
443330            CDS       T03117                                 

Gene name
ADORA3
Definition
(RefSeq) adenosine receptor A3
  KO
K04268  adenosine receptor A3
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04071  Sphingolipid signaling pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    443330 (ADORA3)
   04022 cGMP-PKG signaling pathway
    443330 (ADORA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443330 (ADORA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:oas04030]
    443330 (ADORA3)
G protein-coupled receptors [BR:oas04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    443330 (ADORA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 443330
NCBI-ProteinID: NP_001009775
Ensembl: ENSOARG00000019630
UniProt: P35342 W5QED6
LinkDB All DBs
Position
1
AA seq 317 aa AA seqDB search
MPVNSTAVSWTSVTYITVEILIGLCAIVGNVLVIWVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVISLGVTIHFYSCLFMTCLMLIFTHASIMSLLAIAVDRYLRVKLTVRYRR
VTTQRRIWLALGLCWLVSFLVGLTPMFGWNMKLSSADENLTFLPCRFRSVMRMDYMVYFS
FFLWILVPLVVMCAIYFDIFYIIRNRLSQSFSGSRETGAFYGREFKTAKSLLLVLFLFAL
CWLPLSIINCILYFDGQVPQTVLYLGILLSHANSMMNPIVYAYKIKKFKETYLLILKACV
ICQPSKSMDPSTEQTSE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcaacagcacggctgtgtcctggaccagcgttacctacatcactgtggagatt
ctcatcgggctctgcgccatagtgggcaacgtgctggtcatctgggtggtcaagctgaac
cccagcctgcagaccaccaccttctatttcattgtctccctagccctggctgacattgct
gtcggggtgctggttatgcctctggccattgtcatcagcctgggtgtcacaatccacttt
tatagctgccttttcatgacctgcttgatgctgatattcacccacgcatccatcatgtcc
ttgctagccattgctgtggaccgatacctgcgggtcaagctcacagtcagatacagaaga
gtcaccacgcaaagaagaatatggttggctctgggcctttgctggctggtgtcattcctg
gtgggattgacccccatgtttggctggaacatgaaactgagctcagcagacgaaaacctc
accttcctaccctgccgattccgttcggtcatgaggatggattacatggtctacttcagc
ttcttcctgtggattctcgttcccctggttgtcatgtgcgccatctactttgatatcttc
tacatcatccggaaccgactcagccagagcttttctggctccagagagacaggcgcattc
tatggacgggagttcaagacagccaagtccctgttactggttcttttcttgtttgctttg
tgctggctgcctttgtccatcatcaactgtatcctctactttgatgggcaagtgccgcag
actgtgctgtacctggggatcctgctctcccacgctaactccatgatgaaccccatcgtc
tatgcttacaaaataaagaagttcaaggaaacctatctcttgatcctcaaagcctgtgtg
atctgccagccctctaagtccatggacccaagcactgagcagacttctgagtag

DBGET integrated database retrieval system