KEGG   Ovis aries (sheep): 101107877
Entry
101107877         CDS       T03117                                 

Gene name
FOXO1
Definition
(RefSeq) forkhead box protein O1
  KO
K07201  forkhead box protein O1
Organism
oas  Ovis aries (sheep)
Pathway
oas04068  FoxO signaling pathway
oas04152  AMPK signaling pathway
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04910  Insulin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04922  Glucagon signaling pathway
oas04931  Insulin resistance
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas05165  Human papillomavirus infection
oas05200  Pathways in cancer
oas05202  Transcriptional misregulation in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101107877 (FOXO1)
   04152 AMPK signaling pathway
    101107877 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101107877 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101107877 (FOXO1)
   04922 Glucagon signaling pathway
    101107877 (FOXO1)
   04919 Thyroid hormone signaling pathway
    101107877 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    101107877 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    101107877 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101107877 (FOXO1)
   05202 Transcriptional misregulation in cancer
    101107877 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101107877 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101107877 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101107877 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101107877 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101107877 (FOXO1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    101107877 (FOXO1)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 101107877
NCBI-ProteinID: XP_027829397
UniProt: A0A6P7EE17
LinkDB
Position
10
AA seq 667 aa
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGGAAANPDGAAGLPS
ASAAAVNADFMSSLSLLEESGDFQQAPGSVAAAAAAAAAVAAAAAAAAAAATGGLCGDFQ
GPEAGCLHSAPPQPPPPGPLSQHPPVPPAAAAAAGGPLAGQPRKSSSSRRNAWGNLSYAD
LITKAIESSAEKRLTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQ
NEGTGKSSWWMLNPEGGKSGKSPRRRAASMDNNSKFAKSRGRAAKKKASLQSGQEGAGDS
PGSQFSKWPASPGSHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGDGDVHSMV
YPPSAAKMASTLPSLSEISNPENMENLLDNLNLLSSPASLAVSTQSSPGTMMPQTPCYSF
APPSTSLNSPSPSYQKYTYGQSSMSPLPQMPMQTLQDSKSSYGGMSQYCAPGLLKELLTS
DSPPHSDIMTPVDPGVAQANSRVLGQNVLMGPNSVMPAYGGQASHNKMMTPSSHTHPGHA
QSTSAVNGRALPHAVNTMPHTSGMNRLAPVKTALQVPLAHPMQMSALGGYSSVSSCNGYG
RMGVLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTT
THSWVSG
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggccgaagcgccccaggtggtggagatcgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgccccggccggagtttagccagtccaactcggccacctcc
agcccggcgccgtcgggcggcgcagcggcgaaccccgacggcgccgcgggcctgccctcg
gcctcggcggccgctgtcaatgccgacttcatgagcagcctgagcctgctggaggagagc
ggggacttccaacaggcgcccggctccgtggcggcagccgcggcggcggcggcggcggtg
gcggcggctgctgcggcggccgcagctgctgccaccggggggctgtgtggcgacttccag
ggcccggaggcgggctgcctgcactcggcgccgccgcagcccccgccgcccggcccgctg
tcgcagcacccgcccgtgcctcccgccgcggccgccgccgccggcgggccgctcgcgggg
cagccgcgcaagagcagctcgtcccgccgcaacgcgtggggcaacctgtcctacgccgac
ctcatcaccaaggccatcgagagctcggccgaaaagcggctcacgctgtcgcagatctac
gagtggatggtcaagagcgtgccctacttcaaggataagggcgacagcaacagctcggcg
ggctggaagaattcaattcgtcataatctgtccctgcacagcaagttcatccgtgtgcag
aatgaaggaactggaaaaagctcctggtggatgctcaatccagagggaggcaagagtggg
aaatcccccaggagaagagccgcatccatggacaacaacagtaaatttgccaagagccga
ggccgagctgccaagaaaaaagcatccctgcagtcgggccaggagggtgccggggacagc
ccgggatcgcagttttccaagtggcccgcgagccccggctctcacagcaatgacgacttc
gacaactggagtacctttcgccctcgaaccagctcgaacgctagtaccattagcgggagg
ctctctcccatcatgacggagcaggacgacctgggagacggggacgtgcactcaatggtg
tacccgccgtccgccgcaaagatggcttctactctgcccagtctgtccgagatcagtaac
cccgagaacatggagaaccttctggataatctcaacctcctctcgtcaccagcgtcatta
gccgtgtccacccagtcctcaccgggcaccatgatgccacagacgccctgctactccttt
gcgccgccgagcaccagtctgaattcacccagccccagctaccaaaagtacacgtacggc
cagtccagcatgagccccctgccccagatgcccatgcagacgctgcaggacagcaaatcg
agttacggaggcatgagccagtactgtgcgccgggactcctgaaggagctgctgacgtcc
gactcgcctccgcacagtgacatcatgacgccagtcgatccgggggtggctcaagccaac
agccgagtgctcggccagaacgtgctgatgggccccaactcggtcatgccggcctacggc
ggccaggcctctcacaacaaaatgatgacccccagctcccacacccacccgggacacgct
cagtcaacatccgcagtcaatgggcgtgccttgccccacgctgtaaacaccatgccccac
acctcgggtatgaaccgcctggccccggtgaagacagctttacaagtgcctctggcccac
cccatgcagatgagcgcgctagggggctactcctcggtgagcagctgcaacggctatggc
cggatgggcgttctccaccaggagaagctccccagtgacttggacggcatgtttatcgag
cgcttggactgtgacatggagtccatcattcggaacgacctcatggatggagacacgttg
gattttaactttgacaacgtgttgcccaaccaaagcttcccgcacagtgtcaagacgaca
acacacagctgggtgtcaggctga

DBGET integrated database retrieval system