KEGG   Ovis aries (sheep): 101107944
Entry
101107944         CDS       T03117                                 

Gene name
MSH2
Definition
(RefSeq) DNA mismatch repair protein Msh2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
oas  Ovis aries (sheep)
Pathway
oas01524  Platinum drug resistance
oas03430  Mismatch repair
oas05200  Pathways in cancer
oas05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101107944 (MSH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101107944 (MSH2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101107944 (MSH2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101107944 (MSH2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101107944 (MSH2)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     101107944 (MSH2)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_II MutS_I MutS_IV AAA_27 ArdA
Other DBs
NCBI-GeneID: 101107944
NCBI-ProteinID: XP_014949880
Ensembl: ENSOARG00000005136
LinkDB
Position
3
AA seq 934 aa
MAVQPKDTLQLESAAEVGFVRFFQGMPEKPTTTVRLFDRGDFYTAHQEDALLAAREVFKT
QGVVKYMGPTGAKTLESVVLSKMNFESFVKDLLLVRQYRVEVYKNRAGNKASKENDWYLA
FKASPGNLSQFEDILFGNNDMSASIGVVGVKMSTVDGQRQVGVGYVDATQRKLGLCEFPD
NDQFSNLEALLIQIGPKECVIPGGETAGDMGKLRQVIQRGGILITERKRADFSTKDIYQD
LNRLLKGKKGEQMNSAVLPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELTTFDFSQYM
KLDIAAVRALNLFQGSVEDTSGSQSLAALLNKCKTPQGQRLVNQWIKQPLMDKNRIEERL
NLVEAFVEDAELRQSLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQA
LEKYEGKHQALLLAVFVTPLIDLRSDFSKFQEMIETTLDMEQVENHEFLVKPSFDPNLSE
LREIMDDLEKKMQSTLVSAARDLGLDPGKQIKLDSSTQFGYYFRVTCKEEKVLRNNKNFS
TVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQNAIVKEIVNISSGYVEPMQTFNDVLA
QLDAVVSFAHVSNAAPVPYVRPVILEKGRGRITLKASRHACVEVQDEVAFIPNDVHFEKD
KQMFHIITGPNMGGKSTYIRQTGVVVLMAQIGCFVPCEWAEVSIVDCILARVGAGDSQLK
GVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATKIGAFCMF
ATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHV
IECAKQKALELEEFQNIGKPQECDEMEPAAKRCYLEREQGEKIIQEFLSKVKQVPFTEMS
EESITRKLKQLKAEVIAKNNSFVNEIISRIKVTA
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggcggtgcagccgaaggacacgctgcagctggagagcgcggccgaggtcggctttgtg
cgcttcttccaaggcatgccggagaagccgaccaccacagtgcgcctttttgaccgaggt
gacttctacaccgcgcaccaggaggacgctctgctggccgcccgcgaagtgttcaagacc
cagggggtggtcaagtatatggggccgacaggagcaaagactctggagagtgttgtgctt
agtaaaatgaattttgagtcttttgtaaaagatcttcttctagttcgtcagtacagagtt
gaagtttataagaacagagctggaaataaggcctccaaggagaatgattggtatttggca
tttaaggcctctccaggtaatctttctcagtttgaagatattctctttggtaacaacgat
atgtctgcttccattggtgttgtgggcgttaaaatgtctacagtcgatggtcaaagacag
gttggagttgggtatgttgacgccacacagaggaagctgggactgtgtgagttccccgat
aacgatcagttctccaatctggaggctctcctgattcagattggaccaaaggagtgtgtt
ataccaggaggggagactgctggagacatggggaaactgaggcaggttattcagagagga
ggaattttgattacagaaagaaaaagagctgacttttccacgaaagatatttatcaggac
ctcaaccggttgttgaaaggcaagaagggagaacagatgaatagtgctgtcttgccagaa
atggagaaccaggttgcagtttcttccttgtctgcagtaatcaaatttttagaactctta
tcagatgactcaaactttggacagtttgaactgactacctttgatttcagccagtacatg
aaattggatattgcagcagtgagagcccttaaccttttccagggttctgttgaagatact
tctggctctcagtctctggccgcattgctgaataaatgcaaaacccctcaaggacaaagg
ctggttaaccagtggattaagcagcctcttatggacaagaacagaatagaagagagatta
aatttggtagaagcttttgtagaagatgcagaattgaggcagagtttacaagaagattta
cttcgtcgatttccagatcttaaccgacttgccaagaaatttcaaagacaagcggcaaat
ttacaagattgttaccgactctatcagggtataaatcaactccctaatgttattcaggct
ttggaaaaatatgaaggaaaacatcaggcattgttgctggcagtttttgtgactcctctt
attgatcttcgttctgacttctccaagtttcaagaaatgatagaaacaactttagatatg
gaacaggtggaaaaccatgaattccttgtaaaaccttcatttgatcctaacttgagtgaa
ttaagagaaataatggatgacttagaaaagaagatgcagtcaacattagtaagtgcagct
agagatctaggcttagatcctggcaaacagattaaactggattccagcacacagtttggc
tattatttccgagtaacgtgcaaggaagaaaaagtccttcgtaataataaaaatttcagt
acagtagatatccagaagaatggtgttaaatttacaaacagtaaactgacttctctcaat
gaagagtataccaaaaataaaactgaatatgaggaagcccagaatgccattgttaaagaa
attgtcaatatttcttcaggctatgtagaaccgatgcagacattcaacgacgtgttagct
cagctggatgctgttgtcagctttgctcacgtgtccaatgcagcacctgttccatatgta
cggccagtcattttggaaaaaggacgagggagaattacactgaaagcatccagacatgct
tgtgtggaagttcaagatgaagtcgcatttattcctaatgatgttcactttgaaaaagat
aaacaaatgttccacatcattactggtcccaacatgggagggaaatcaacatatattcgc
cagactggggtagtagttctcatggcccagattgggtgttttgtgccatgtgagtgggca
gaagtgtccattgtggactgcatcttggcccgggtaggggctggtgacagtcagttgaaa
ggagtctccacatttatggctgaaatgttagaaactgcttctattctcaggtctgcaacc
aaagattccttaataatcatagatgaattgggaagaggaacctctacctatgatggattt
ggattagcgtgggctatatcagagtacattgcaacgaagatcggtgctttttgcatgttt
gcaacccattttcatgaacttacagccttggccaatcaaatacccactgttaataatctg
catgtcacagcactaactactgaagagactttaactatgctttatcaggtgaagaaaggt
gtctgtgatcaaagttttgggattcatgttgctgagcttgctaatttccccaggcatgta
atagagtgtgccaaacagaaagccctggagctggaggagtttcagaatattgggaaacca
caggaatgtgatgaaatggaaccagcagcaaagaggtgctatctggaaagagagcaaggt
gaaaaaattattcaagaatttctgtccaaggtaaagcaagtgccctttactgaaatgtca
gaagaaagcatcacaagaaagttaaaacagctaaaagctgaggtgatcgcaaagaataat
agctttgtaaatgaaatcatttcccgaataaaggtaactgcgtga

DBGET integrated database retrieval system