KEGG   Ovis aries (sheep): 101108012Help
Entry
101108012         CDS       T03117                                 

Gene name
HDAC4
Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
oas  Ovis aries (sheep)
Pathway
oas04371  Apelin signaling pathway
oas05034  Alcoholism
oas05165  Human papillomavirus infection
oas05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101108012 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    101108012 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    101108012 (HDAC4)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    101108012 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101108012 (HDAC4)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101108012 (HDAC4)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101108012 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 101108012
NCBI-ProteinID: XP_014947122
LinkDB All DBs
Position
1
AA seq 1392 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVASALPLPVAPRRVAIDLRPGPQFPLP
VAEPGLREQQLQQELLALKQKQQLQRQILIAEFRRQHEQLSRQHGGPAGTSTLRSVPASG
PGARRSRAQDPPTAQTPAAARLGSSRHRRSPDPAARDLPGRRRAGPLCVPQSLAAQDHPR
APRLAPVLGTTPARHCPAFSGMQRRGPWAGACSHSPPLSPAPGAVASTEVKMKLQEFVLN
KKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGASASYNHPVLGMYDAKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLSQRDSACSSAPGSAPS
SPNNSSGNVSTENGIAPTVPSIPAETSLAHRLVAREGSVGPLPLYTSPSLPNITLGLPAT
GPSTGAAGQQEAERLALPALQQRVSLFPGAHLAPYLGTAPLERDTGAAPGSLLQHVVLLE
QPPAQTPLVTGEQAASGRPGLPGRGGRPVPQNACSQALPCQAVARRASEGPSEEAGPPCP
QEEPLSTGYPQVPSLGLDKGSYPASLHRAPVLGLPTYDLDWVWRYQMTGHCPQVQASGGQ
RDREQDLAGFGPGRMAVPDDWPLPLLWRPNWAWLRTPRVHKLHPRKRPVQSTAHRTCPWR
NVSRNGTGQGQEWVGRLNAALRGRKGTFKVDKTEAEVSEALCVTFLMPTVFLLALCRSLS
DRMIPKPSEPARQPESHPEETEEELREHQALLEEPFCPVLPQPRPRSAPLTPRRGLCDHP
LPLPAPPSSPSRRTPPGNPVLQMIPKPSEPARQPESHPEETEEELREHQALLEEPFLDRL
PGQKEAHALAGVQVKQEPIESDDEEAEPPREADPGQRLPTEQELLFRQQALLLEQQRIHQ
LRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPAKPRFTTGLVYDTLMLK
HQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSETHALLYG
TNPLNRQKLDSSLASVFVRLPCVAVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGE
LKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLSVSKTLVVDWDVHHGNGTQQ
AFYSDPRVLYISLHRYDDGNFFPGSGAPDEVSGAPSVGFNVNMAFTGGLDPPMGDAEYLA
AFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRVV
LALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVIEIHSQYWR
SLQRLASTAGYSLVEAQKCENEEAETVTAMASLSVAVKAPEKSRTRRGAHGRGAASVAAP
AAAGLLFCLSPS
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcaaagccatccagatggactttctggccgagaccagccagtggagctgctc
aaccccgcccgtgtgaaccacatgcccagcaccgtggacgtggcctcggccctgcctctg
ccggtggcgccccgccgggtggccatagacctgcgccctggaccacagttcccgctgccc
gtggcggagccgggcctccgtgagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagctgcagagacagatcctcatcgccgagttccggcggcagcacgagcagctg
tcgcggcagcacggaggcccagctggcacgagcacactaaggtcagtccccgcctcgggc
ccaggcgcccgacgctcgcgcgcccaggacccgccaactgcccagacccccgccgccgcc
cgcctcggatcctctcggcaccgtcgcagcccagatcccgccgcccgggacctgcccggt
cgccgccgggccggcccgctctgtgtgccccaaagtcttgccgcccaggaccatccccga
gcccccagactggcccctgtgttgggaaccacccctgcccgtcactgccctgccttttcc
ggcatgcagcgcagggggccctgggctggagcctgcagtcactcgcccccgctctctccc
gcgccaggcgccgtggccagcacggaagtgaagatgaagctgcaggagtttgtcctcaat
aaaaagaaggccctggctcatcggaacctgaaccactgcatgtccagcgaccctcgctac
tggtacgggaagacgcagcacagctcactggaccagagctccccgccccagagcggggcg
tcggcctcctacaaccacccggtcctgggcatgtacgacgccaaagacgacttccccctc
agaaagacagcttctgaacccaacctgaaattgcgctccaggctaaagcagaaagtggct
gagagacggagcagtcccctgctacgcaggaaagatgggccagtggtcacggctctgaaa
aagcgccccttgtctcagagagactcggcgtgcagcagtgccccaggctccgcgcccagc
tcgcccaacaacagctccgggaacgtgagcacggagaacgggattgcgcccaccgtcccc
agcatcccggccgagaccagcctggcgcacagactcgtggcgcgagagggctcggtgggc
ccgctgcccctctacacctcaccatccctgcccaacatcacgctggggctgcccgccacc
ggcccctccacgggggcagccggccagcaggaggccgagagactggccctccccgccctg
cagcagcgcgtctccctcttccccggcgcccacctcgccccctacctgggcacggcgccc
ctggagcgtgacacaggggcggcccctggctccctgctgcagcacgtggtcctcctggag
cagccgccggcacagacgcccctcgtcacaggtgagcaggccgcatcgggccgtcctggg
ctccctgggcggggcgggcgacctgtcccccagaacgcctgctcccaagccctcccatgc
caggctgtggccagaagagcctcagaggggccctctgaagaggcgggcccgccctgcccc
caggaggagccactcagcaccggctaccctcaggtcccttcactggggctggacaagggc
agctatccagccagcctccacagggcgcctgtgctggggctgcccacttacgacctggac
tgggtatggcggtaccagatgactggccactgcccccaagtccaggcctcgggggggcag
cgtgacagggagcaggacctggcgggcttcgggcctgggcgtatggcggtaccggatgac
tggccactgcccctgttgtggcggccgaactgggcgtggctgcgcacgcctcgcgtgcac
aagctgcaccctagaaaaaggccagtgcagagcaccgcccatcgcacctgcccctggcgc
aacgtctccaggaatggcacagggcagggtcaggagtgggtggggcggctgaacgcagcc
ctgcggggcaggaaaggcacctttaaggtggacaagacggaggccgaagtgtcagaggca
ctctgcgtcacctttctgatgccgacggtcttcttgcttgcgttgtgccgttctctgagt
gataggatgatccccaaacccagcgagccagcccggcagcccgagagccaccccgaggag
acggaggaggagctgcgggagcaccaggcactcctggaggagcccttctgtcctgtcctg
cctcagcccaggccccggtcggccccgctgaccccgagacgtgggctctgtgaccacccc
cttcctctcccagcacctccctcatccccatcccgccgcactccacctggtaaccctgtg
ttacagatgatccccaaacccagcgagccagcccggcagcccgagagccaccccgaggag
acggaggaggagctgcgggagcaccaggcactcctggaggagcccttcctggaccggctc
ccggggcagaaggaggcccatgcgctggctggggtgcaggtgaagcaggagcccatcgag
agtgacgacgaggaggcggagcccccacgggaggcggaccccggccagcggctgcccacg
gagcaggagctgctcttcagacagcaagccctcctcctggagcagcagcggatccaccag
ctgaggaactaccaggcatccatggaggccgctggcatccccgtgtccttcggcgggcac
cggcccctatcccgggcgcagtcctcccccgcgtctgccaccttccctatgtccgtgcag
gagcccccagccaagccgaggtttaccacaggcctcgtgtacgacacgctgatgctgaag
caccagtgcacctgcgggaacaccaacagccacccggagcacgccgggcgcatccagagc
atctggtcgcggctgcaggagaccggcctgcgaggcaaatgtgagtgcatccgtggacgg
aaggccacgctggaggagctgcagacggtgcactcggagacgcacgccctgctctacggc
acgaaccccctcaacaggcagaaactggacagctcattggcgtccgtgttcgtcagactc
ccatgtgtggcggtcggagtggacagtgataccatatggaacgaggtgcactcgtcgggg
gctgcccgcctggctgtgggctgtgtggtggagctggtcttcaaggtggccacgggggag
ctgaagaatggctttgctgtggtccgccctccaggacaccacgcagaggagagcacgccc
atggggttctgctacttcaactccgtggccatcgctgccaagcttctccagcaaaggctg
agcgtgagcaagaccctcgtggtagactgggacgtgcaccacgggaacgggacccagcag
gccttctacagcgacccccgagtgctctacatctccctgcaccgctacgacgacggcaac
ttcttcccaggcagcggcgcccccgacgaggtgagcggggccccgtctgtgggcttcaac
gtcaacatggctttcaccggcggcctggacccccccatgggagacgcagagtacctggcg
gccttcaggactgtggtcatgccgatcgccagcgagttcgccccagacgtggtgctggtg
tcctcgggcttcgacgctgtggagggccaccccacgcccctcggaggctacaacctctcc
gccaaatgtttcgggtacctgacgaagcagctaatgggcctggccggtggccgggttgtc
ctggcgctggaggggggccacgatctcacagccatctgcgacgcctcggaagcctgcgtc
tctgctctgctggggaatgagctcgatcctctcccagaaaaggtcttacagcagagaccc
aacgccaacgccgtgcggtcgatggagaaggtcattgaaatccacagccagtactggcgc
tccctgcagaggctcgcctccaccgctggctactccctggtcgaggcccagaagtgtgag
aacgaggaagccgagactgtcactgccatggcctcgctgtctgtggccgtgaaggcccct
gagaagagcagaacccgacgaggagcccatggaagaggagccgcctctgtagccgctccc
gcagctgcgggtctcttgttttgtctgtctccgtcttga

DBGET integrated database retrieval system