KEGG   Ovis aries (sheep): 101108012Help
Entry
101108012         CDS       T03117                                 

Gene name
HDAC4
Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
oas  Ovis aries (sheep)
Pathway
oas04371  Apelin signaling pathway
oas05034  Alcoholism
oas05165  Human papillomavirus infection
oas05169  Epstein-Barr virus infection
oas05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101108012 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    101108012 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    101108012 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    101108012 (HDAC4)
   05165 Human papillomavirus infection
    101108012 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101108012 (HDAC4)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101108012 (HDAC4)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     101108012 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 101108012
NCBI-ProteinID: XP_014947122
LinkDB All DBs
Position
1
AA seq 1392 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVASALPLPVAPRRVAIDLRPGPQFPLP
VAEPGLREQQLQQELLALKQKQQLQRQILIAEFRRQHEQLSRQHGGPAGTSTLRSVPASG
PGARRSRAQDPPTAQTPAAARLGSSRHRRSPDPAARDLPGRRRAGPLCVPQSLAAQDHPR
APRLAPVLGTTPARHCPAFSGMQRRGPWAGACSHSPPLSPAPGAVASTEVKMKLQEFVLN
KKKALAHRNLNHCMSSDPRYWYGKTQHSSLDQSSPPQSGASASYNHPVLGMYDAKDDFPL
RKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLSQRDSACSSAPGSAPS
SPNNSSGNVSTENGIAPTVPSIPAETSLAHRLVAREGSVGPLPLYTSPSLPNITLGLPAT
GPSTGAAGQQEAERLALPALQQRVSLFPGAHLAPYLGTAPLERDTGAAPGSLLQHVVLLE
QPPAQTPLVTGEQAASGRPGLPGRGGRPVPQNACSQALPCQAVARRASEGPSEEAGPPCP
QEEPLSTGYPQVPSLGLDKGSYPASLHRAPVLGLPTYDLDWVWRYQMTGHCPQVQASGGQ
RDREQDLAGFGPGRMAVPDDWPLPLLWRPNWAWLRTPRVHKLHPRKRPVQSTAHRTCPWR
NVSRNGTGQGQEWVGRLNAALRGRKGTFKVDKTEAEVSEALCVTFLMPTVFLLALCRSLS
DRMIPKPSEPARQPESHPEETEEELREHQALLEEPFCPVLPQPRPRSAPLTPRRGLCDHP
LPLPAPPSSPSRRTPPGNPVLQMIPKPSEPARQPESHPEETEEELREHQALLEEPFLDRL
PGQKEAHALAGVQVKQEPIESDDEEAEPPREADPGQRLPTEQELLFRQQALLLEQQRIHQ
LRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPAKPRFTTGLVYDTLMLK
HQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSETHALLYG
TNPLNRQKLDSSLASVFVRLPCVAVGVDSDTIWNEVHSSGAARLAVGCVVELVFKVATGE
LKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLSVSKTLVVDWDVHHGNGTQQ
AFYSDPRVLYISLHRYDDGNFFPGSGAPDEVSGAPSVGFNVNMAFTGGLDPPMGDAEYLA
AFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRVV
LALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKVIEIHSQYWR
SLQRLASTAGYSLVEAQKCENEEAETVTAMASLSVAVKAPEKSRTRRGAHGRGAASVAAP
AAAGLLFCLSPS
NT seq 4179 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcaaagccatccagatggactttctggccgagaccagccagtggagctgctc
aaccccgcccgtgtgaaccacatgcccagcaccgtggacgtggcctcggccctgcctctg
ccggtggcgccccgccgggtggccatagacctgcgccctggaccacagttcccgctgccc
gtggcggagccgggcctccgtgagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagctgcagagacagatcctcatcgccgagttccggcggcagcacgagcagctg
tcgcggcagcacggaggcccagctggcacgagcacactaaggtcagtccccgcctcgggc
ccaggcgcccgacgctcgcgcgcccaggacccgccaactgcccagacccccgccgccgcc
cgcctcggatcctctcggcaccgtcgcagcccagatcccgccgcccgggacctgcccggt
cgccgccgggccggcccgctctgtgtgccccaaagtcttgccgcccaggaccatccccga
gcccccagactggcccctgtgttgggaaccacccctgcccgtcactgccctgccttttcc
ggcatgcagcgcagggggccctgggctggagcctgcagtcactcgcccccgctctctccc
gcgccaggcgccgtggccagcacggaagtgaagatgaagctgcaggagtttgtcctcaat
aaaaagaaggccctggctcatcggaacctgaaccactgcatgtccagcgaccctcgctac
tggtacgggaagacgcagcacagctcactggaccagagctccccgccccagagcggggcg
tcggcctcctacaaccacccggtcctgggcatgtacgacgccaaagacgacttccccctc
agaaagacagcttctgaacccaacctgaaattgcgctccaggctaaagcagaaagtggct
gagagacggagcagtcccctgctacgcaggaaagatgggccagtggtcacggctctgaaa
aagcgccccttgtctcagagagactcggcgtgcagcagtgccccaggctccgcgcccagc
tcgcccaacaacagctccgggaacgtgagcacggagaacgggattgcgcccaccgtcccc
agcatcccggccgagaccagcctggcgcacagactcgtggcgcgagagggctcggtgggc
ccgctgcccctctacacctcaccatccctgcccaacatcacgctggggctgcccgccacc
ggcccctccacgggggcagccggccagcaggaggccgagagactggccctccccgccctg
cagcagcgcgtctccctcttccccggcgcccacctcgccccctacctgggcacggcgccc
ctggagcgtgacacaggggcggcccctggctccctgctgcagcacgtggtcctcctggag
cagccgccggcacagacgcccctcgtcacaggtgagcaggccgcatcgggccgtcctggg
ctccctgggcggggcgggcgacctgtcccccagaacgcctgctcccaagccctcccatgc
caggctgtggccagaagagcctcagaggggccctctgaagaggcgggcccgccctgcccc
caggaggagccactcagcaccggctaccctcaggtcccttcactggggctggacaagggc
agctatccagccagcctccacagggcgcctgtgctggggctgcccacttacgacctggac
tgggtatggcggtaccagatgactggccactgcccccaagtccaggcctcgggggggcag
cgtgacagggagcaggacctggcgggcttcgggcctgggcgtatggcggtaccggatgac
tggccactgcccctgttgtggcggccgaactgggcgtggctgcgcacgcctcgcgtgcac
aagctgcaccctagaaaaaggccagtgcagagcaccgcccatcgcacctgcccctggcgc
aacgtctccaggaatggcacagggcagggtcaggagtgggtggggcggctgaacgcagcc
ctgcggggcaggaaaggcacctttaaggtggacaagacggaggccgaagtgtcagaggca
ctctgcgtcacctttctgatgccgacggtcttcttgcttgcgttgtgccgttctctgagt
gataggatgatccccaaacccagcgagccagcccggcagcccgagagccaccccgaggag
acggaggaggagctgcgggagcaccaggcactcctggaggagcccttctgtcctgtcctg
cctcagcccaggccccggtcggccccgctgaccccgagacgtgggctctgtgaccacccc
cttcctctcccagcacctccctcatccccatcccgccgcactccacctggtaaccctgtg
ttacagatgatccccaaacccagcgagccagcccggcagcccgagagccaccccgaggag
acggaggaggagctgcgggagcaccaggcactcctggaggagcccttcctggaccggctc
ccggggcagaaggaggcccatgcgctggctggggtgcaggtgaagcaggagcccatcgag
agtgacgacgaggaggcggagcccccacgggaggcggaccccggccagcggctgcccacg
gagcaggagctgctcttcagacagcaagccctcctcctggagcagcagcggatccaccag
ctgaggaactaccaggcatccatggaggccgctggcatccccgtgtccttcggcgggcac
cggcccctatcccgggcgcagtcctcccccgcgtctgccaccttccctatgtccgtgcag
gagcccccagccaagccgaggtttaccacaggcctcgtgtacgacacgctgatgctgaag
caccagtgcacctgcgggaacaccaacagccacccggagcacgccgggcgcatccagagc
atctggtcgcggctgcaggagaccggcctgcgaggcaaatgtgagtgcatccgtggacgg
aaggccacgctggaggagctgcagacggtgcactcggagacgcacgccctgctctacggc
acgaaccccctcaacaggcagaaactggacagctcattggcgtccgtgttcgtcagactc
ccatgtgtggcggtcggagtggacagtgataccatatggaacgaggtgcactcgtcgggg
gctgcccgcctggctgtgggctgtgtggtggagctggtcttcaaggtggccacgggggag
ctgaagaatggctttgctgtggtccgccctccaggacaccacgcagaggagagcacgccc
atggggttctgctacttcaactccgtggccatcgctgccaagcttctccagcaaaggctg
agcgtgagcaagaccctcgtggtagactgggacgtgcaccacgggaacgggacccagcag
gccttctacagcgacccccgagtgctctacatctccctgcaccgctacgacgacggcaac
ttcttcccaggcagcggcgcccccgacgaggtgagcggggccccgtctgtgggcttcaac
gtcaacatggctttcaccggcggcctggacccccccatgggagacgcagagtacctggcg
gccttcaggactgtggtcatgccgatcgccagcgagttcgccccagacgtggtgctggtg
tcctcgggcttcgacgctgtggagggccaccccacgcccctcggaggctacaacctctcc
gccaaatgtttcgggtacctgacgaagcagctaatgggcctggccggtggccgggttgtc
ctggcgctggaggggggccacgatctcacagccatctgcgacgcctcggaagcctgcgtc
tctgctctgctggggaatgagctcgatcctctcccagaaaaggtcttacagcagagaccc
aacgccaacgccgtgcggtcgatggagaaggtcattgaaatccacagccagtactggcgc
tccctgcagaggctcgcctccaccgctggctactccctggtcgaggcccagaagtgtgag
aacgaggaagccgagactgtcactgccatggcctcgctgtctgtggccgtgaaggcccct
gagaagagcagaacccgacgaggagcccatggaagaggagccgcctctgtagccgctccc
gcagctgcgggtctcttgttttgtctgtctccgtcttga

DBGET integrated database retrieval system