KEGG   Ovis aries (sheep): 101108127Help
Entry
101108127         CDS       T03117                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase isoform X2
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
oas  Ovis aries (sheep)
Pathway
oas00010  Glycolysis / Gluconeogenesis
oas00053  Ascorbate and aldarate metabolism
oas00071  Fatty acid degradation
oas00260  Glycine, serine and threonine metabolism
oas00280  Valine, leucine and isoleucine degradation
oas00310  Lysine degradation
oas00330  Arginine and proline metabolism
oas00340  Histidine metabolism
oas00380  Tryptophan metabolism
oas00410  beta-Alanine metabolism
oas00561  Glycerolipid metabolism
oas00620  Pyruvate metabolism
oas01100  Metabolic pathways
Module
oas_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
oas_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101108127 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    101108127 (ALDH7A1)
   00620 Pyruvate metabolism
    101108127 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101108127 (ALDH7A1)
   00561 Glycerolipid metabolism
    101108127 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101108127 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    101108127 (ALDH7A1)
   00310 Lysine degradation
    101108127 (ALDH7A1)
   00330 Arginine and proline metabolism
    101108127 (ALDH7A1)
   00340 Histidine metabolism
    101108127 (ALDH7A1)
   00380 Tryptophan metabolism
    101108127 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101108127 (ALDH7A1)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     101108127 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     101108127 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     101108127 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 101108127
NCBI-ProteinID: XP_004008714
Ensembl: ENSOARG00000018344
UniProt: W5QAE8
LinkDB All DBs
Position
5
AA seq 539 aa AA seqDB search
MWRVPGLLCVRVARKSKFSGPWTRPAAFMSTLLINQPQYAWLKELGLREENDGVYNGSWG
GRGEVITTYCPANNEPIARVRQASMADYEETVEKAREAWSIWADIPAPKRGEIVRQIGDA
LREKIQVLGSLVSLEMGKILVEGVGEVQEYVDVCDYAVGLSRMIGGPILPSERPGHALIE
QWNPVGLVGIITAFNFPVAVYGWNNAIAMICGNACLWKGAPTTSLISVAVTKIIAKVLED
NKLPGAICSLTCGGADVGTAMAKDERVDLLSFTGSTQVGKQVALMVQERFGRSLLELGGN
NAIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLKKAYAQIRVG
NPWDSNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLEHD
ASIVHTETFAPILYVFKFKNEDEVFAWNNEVKQGLSSSIFTKDMGRIFRWLGPKGSDCGI
VNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgcgttcccggtctgctctgcgtgcgcgttgcaaggaagagcaagttctccgga
ccttggaccaggcctgccgccttcatgtccactctgctcatcaatcagcctcagtatgct
tggctgaaggagctggggctccgcgaggaaaacgacggcgtgtataatggaagctgggga
ggccggggagaggtaatcaccacctattgtcctgctaacaatgagcccattgccagagtc
agacaggccagcatggctgactatgaagaaactgtagagaaagcaagagaagcatggagc
atctgggcagatattcctgctccaaagcgaggagaaatcgtgagacagattggtgatgcc
ttgcgggagaagatccaagtgctaggaagcttggtgtctttggagatggggaagatcttg
gtggaaggtgtgggagaagttcaggaatacgtggatgtttgtgattatgctgttggctta
tctaggatgattgggggacccatcctgccttctgaaagacctggccatgctctcattgaa
cagtggaatcctgtaggcctggttggaatcatcactgctttcaacttccctgtggccgtg
tatggctggaacaacgccattgccatgatctgcgggaacgcttgcctttggaaaggagct
cctacaacttccctcattagtgtagctgtcacaaagataatagccaaagttctggaggac
aacaagctgcctggtgcaatttgttccttgacttgtggtggagcagatgtcggcacagca
atggccaaggatgagcgggtggacctgctgtccttcaccgggagcactcaggtgggaaaa
caggtggcgctcatggtacaggagaggtttgggagaagtttattagaacttggaggaaac
aatgccattatagcttttgaggacgcggacctcagcttagtcgtcccctcagctctcttt
gcagccgtggggacagccggccagaggtgtaccactgcgaggcgcctgttcttacatgaa
agcatccatgatgaagttgtcaatagacttaaaaaggcctatgcacagatccgtgttggg
aacccttgggactctaacgttctctatgggccactccacaccaaacaggcagtaagcatg
tttcttggagcagtggaagaagcaaagaaggaaggtggcaccgttgtctatggtggcaag
gttatggatcgccctggaaattacgtagaaccgacaatcgtgacaggtcttgagcatgac
gcatccattgtacacacagagacttttgccccgattctttatgtctttaaattcaagaat
gaagatgaggtctttgcatggaacaatgaagtcaaacagggactttcaagtagcatcttt
accaaggatatgggcagaatctttcgctggcttggaccaaaaggatcagattgtggcatt
gtaaacgtcaacattccaacgagtggggctgagattggaggtgcatttggaggagagaag
cacactggcggtggcagggagtcgggcagtgatgcctggaagcagtacatgagaagatct
acttgtaccatcaactacagtaaggaccttcctctggcccaaggaatcaagtttcagtaa

DBGET integrated database retrieval system