KEGG   Ovis aries (sheep): 101108203
Entry
101108203         CDS       T03117                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X1
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas00230  Purine metabolism
oas01100  Metabolic pathways
oas01522  Endocrine resistance
oas04015  Rap1 signaling pathway
oas04020  Calcium signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04072  Phospholipase D signaling pathway
oas04114  Oocyte meiosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04261  Adrenergic signaling in cardiomyocytes
oas04270  Vascular smooth muscle contraction
oas04371  Apelin signaling pathway
oas04540  Gap junction
oas04611  Platelet activation
oas04713  Circadian entrainment
oas04714  Thermogenesis
oas04723  Retrograde endocannabinoid signaling
oas04724  Glutamatergic synapse
oas04725  Cholinergic synapse
oas04727  GABAergic synapse
oas04740  Olfactory transduction
oas04750  Inflammatory mediator regulation of TRP channels
oas04911  Insulin secretion
oas04912  GnRH signaling pathway
oas04913  Ovarian steroidogenesis
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04918  Thyroid hormone synthesis
oas04921  Oxytocin signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas04962  Vasopressin-regulated water reabsorption
oas04970  Salivary secretion
oas04971  Gastric acid secretion
oas04972  Pancreatic secretion
oas04976  Bile secretion
oas05032  Morphine addiction
oas05163  Human cytomegalovirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05200  Pathways in cancer
oas05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101108203 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101108203 (ADCY3)
   04371 Apelin signaling pathway
    101108203 (ADCY3)
   04020 Calcium signaling pathway
    101108203 (ADCY3)
   04072 Phospholipase D signaling pathway
    101108203 (ADCY3)
   04024 cAMP signaling pathway
    101108203 (ADCY3)
   04022 cGMP-PKG signaling pathway
    101108203 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101108203 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101108203 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101108203 (ADCY3)
   04062 Chemokine signaling pathway
    101108203 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    101108203 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    101108203 (ADCY3)
   04912 GnRH signaling pathway
    101108203 (ADCY3)
   04913 Ovarian steroidogenesis
    101108203 (ADCY3)
   04915 Estrogen signaling pathway
    101108203 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    101108203 (ADCY3)
   04921 Oxytocin signaling pathway
    101108203 (ADCY3)
   04926 Relaxin signaling pathway
    101108203 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    101108203 (ADCY3)
   04918 Thyroid hormone synthesis
    101108203 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    101108203 (ADCY3)
   04916 Melanogenesis
    101108203 (ADCY3)
   04925 Aldosterone synthesis and secretion
    101108203 (ADCY3)
   04927 Cortisol synthesis and secretion
    101108203 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101108203 (ADCY3)
   04270 Vascular smooth muscle contraction
    101108203 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    101108203 (ADCY3)
   04971 Gastric acid secretion
    101108203 (ADCY3)
   04972 Pancreatic secretion
    101108203 (ADCY3)
   04976 Bile secretion
    101108203 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101108203 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101108203 (ADCY3)
   04727 GABAergic synapse
    101108203 (ADCY3)
   04725 Cholinergic synapse
    101108203 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    101108203 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    101108203 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    101108203 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    101108203 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    101108203 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101108203 (ADCY3)
   04714 Thermogenesis
    101108203 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101108203 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    101108203 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101108203 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101108203 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101108203 (ADCY3)
   05163 Human cytomegalovirus infection
    101108203 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101108203 (ADCY3)
Enzymes [BR:oas01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101108203 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 101108203
NCBI-ProteinID: XP_027822362
Ensembl: ENSOARG00000018077
LinkDB
Position
3
AA seq 1145 aa
MPRTQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSADKLAPLTVAGVGLVLDII
LFVLCKKGLLPNRVTRRVVPYLLWLLISAQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVAHTLVLGVTVAQQQQDGLKGVRLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGEGGSRCD
YLEEKGIETYLIIASKPEVKKTAAQNGLNGSALLNGAPPSSKPSSPALIETKESNGSIHT
SSSISEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTAVVEILIDPWLMTN
YVTFVVGEALLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPTNGTAEMQVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIVGAVAVINVYAWRPIFDDYDHKRFQQHNFPMVALEKMQVFSSSGLNGTDRLPLVPSK
YSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGASITLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctctgagcccgagtactccgctgagtactcggccgagtac
tctgtcagcctgccttcggaccctgaccgcggggtgggccggacccatgaaatctcagtt
cggaactcggggtcgtgcctctgcttacctcgcttcatgcgactgaccttcgtaccagag
tccttggagaacctgtaccagacttacttcaagaggcagcgccatgagaccctgctggtg
ctggtggtctttgcggccctcttcgactgctatgtggtggtcatgtgcgccgtggtcttc
tctgctgacaagctggcccccctcaccgtggccggggttgggctggtgttggacatcatc
cttttcgtgctctgcaaaaaggggctgctccccaaccgggtcactcggagagtggtgccc
tacctgctgtggctgctgatatcagcccaggtcttctcctacctgggcctgaacttctcc
cgtgcccatgcggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgcgtcgcg
cacacactcgtcttgggggtcaccgtggcccagcagcagcaggacgggctgaagggagtg
cggttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tctctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctg
tccatcctgcccaagcacgtggccgacgagatgctgaaggacatgaagaaggatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaatgtcagcatc
ctctttgctgatattgtgggcttcacccagctgtcctcagcttgcagtgcccaggagctt
gtgaagctgctcaatgagctctttgcccgctttgacaagctggcggctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcgggctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagacgaagactggggtggacatgcgagtgggggtacacacgggcaccgtg
ctggggggcgtcctcggccagaaacgctggcagtatgatgtgtggtccaccgacgtcacc
gtggccaacaagatggaggctggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggagagttcgacgtggagccgggcgaggggggcagtcgctgtgat
tacctggaagagaagggcatcgagacctacctcatcatcgcttccaagccagaggtgaag
aaaacagctgcccaaaacggccttaacggctcggccctgctgaatggagcgccgccttcc
tcaaagcccagctcccctgccctcattgagaccaaggagtccaacgggagcattcacacc
agcagctctatatctgaggagcccgaggagcaagatgcccaggccgacaacccatcgttc
cccaaccctcgccgaaggctgcgccttcaggacctggctgatcgcgtggtggacgcctct
gaggacgagcatgagctcaaccagctactcaacgaggcgctgctcgagcgagagtctgcc
caggtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccctgagatg
gagacccgctactcagtagagaaggagaagcagagcggggctgccttcagctgctcctgc
gttgtcctgctctgcacggccgtggtggagatcctcattgacccctggctcatgacgaac
tatgtgacctttgtggttggggaggctctgctcctgatactgaccatctgttcgctggct
gccatctttccacgggcctttcctaagaagcttgtggccttctctacttggatcgaccgg
acacgctgggccaggaacacctgggccatgctggccatcttcattcttgtcatggcaaac
gtggtggacatgctcagctgtctccagtactacacaggccctaccaacggcaccgcagag
atgcaggtggaggacggctgcgtggagaaccccaagtactacaactacgtggccgtgctg
tccctcatcgctaccatcatgctggtgcaggtcagccacatggtcaagctcacactcatg
ctgctcatcgtgggggctgtggctgtcatcaacgtctacgcctggcgccccatctttgat
gactacgaccacaaacgcttccagcaacacaactttccgatggtggccttagagaagatg
caggtgttttccagctcggggctcaatggcactgacaggctgcccctggtgccgtctaag
tactcgatgacagtgatgatcttcgtcatgatgctgagcttttactacttctcccgacac
gtggaaaagctggcacggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaacgaagccttggtcaccaacatgctgcctgagcac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagttatgtttgcctccctgcccaattttgccgacttctacacagaggag
agcatcaataatggcggcattgagtgtctgcgcttcctcaatgagatcatctcagatttt
gactctcttctggacaatcccaagttccgggtcatcaccaagatcaagaccattggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggaggagaagtcagacaaggagcgctggcagcacctggcagacctggctgatttt
gcgctggccatgaaggacacgctcaccaacatcaataaccagtccttcaacaacttcatg
ctgcgcattggaatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaatgtagccagcaggatggagtccacaggggtc
atgggcaacatccaggtggtggaagaaacccaagtcatccttcgagagtatggcttccgc
ttcgtgaggagagggcccatctttgtgaaagggaagggggaactgctaacctttttcttg
aagggccgagacaagctggccacgttccctaacggcgcctcaatcacactgcctcaccag
gtagtagacaactcctga

DBGET integrated database retrieval system