KEGG   Ovis aries (sheep): 101108344
Entry
101108344         CDS       T03117                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
oas  Ovis aries (sheep)
Pathway
oas01524  Platinum drug resistance
oas03430  Mismatch repair
oas03460  Fanconi anemia pathway
oas05200  Pathways in cancer
oas05210  Colorectal cancer
oas05213  Endometrial cancer
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101108344 (MLH1)
   03460 Fanconi anemia pathway
    101108344 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101108344 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101108344 (MLH1)
   05226 Gastric cancer
    101108344 (MLH1)
   05213 Endometrial cancer
    101108344 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101108344 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101108344 (MLH1)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     101108344 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 101108344
NCBI-ProteinID: XP_004018267
Ensembl: ENSOARG00000016550
UniProt: W5Q4Z2
LinkDB
Position
19
AA seq 758 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVVKEGGLKLIQ
IQDNGTGIRKEDLEIVCERFTTSKLQSFEDLAHISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRAHYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYAIHNSGIGFSVKKQGETVADVRTLPNATIVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESASLRKAIETVYAAYLPKSTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILERLQQHIEDRLLGSNASRTYFTQTLLPGLTGPSGEAV
KSTANVTSPSTAGSGDRVYAHQMVRTDCREQKLDAFLQPVSKALSSQPPAVVPEHRTDAS
SSGARQQDEEMLELPAPAEVAAKSQALEDDATMRTAELAEKRGPSSSPENPRKRPREDSD
VEMVEDASRKEMTAACTPRRRIINLTSILSLQEEITERGHETLREMLHNHSFVGCVNPQW
ALAQHQTKLYLLNTTRLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLVGLPLLIDNYVPPLEGLPIFIL
RLATEVNWDEEKECFESLSKECALFYSIRKQYVSAESTLSGQQSEAPGSTANPWKWTVEH
VIYKAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgcttgtagcgggggttatccggaggctggacgagacagtggtgaaccgcatcgcg
gcaggggaagttatccagcggccagctaatgccatcaaggaaatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggttgttaaagagggaggcctgaagttgattcag
attcaagacaatggcactgggatcaggaaagaagatcttgagattgtgtgtgagaggttc
accacaagtaaactgcagtcctttgaggatttagctcatatttctacctatggctttcgg
ggtgaggctttggccagcataagccacgtggctcacgtcaccattacaaccaaaacagct
gacgggaagtgtgcgtacagagctcattactcagatggaaagctgaaagcgcctcctaaa
ccatgtgcaggcaatcaagggacccaaatcacggtggaggaccttttttacaacatatcc
acgaggaggaaagctttaaaaaacccaagcgaagagtatggaaaaattttggaagttgtc
ggcaggtatgcaatacacaattcaggcattggtttctcagttaaaaaacaaggtgaaaca
gtagctgacgtcaggaccctgccgaatgccaccatcgtggacaacattcgctccatcttt
ggaaatgctgttagccgagaattgatagaagttggatgtgaggataaaacccttgccttc
aaaatgaatggctacatatccaatgcaaactattcagtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagagtcagcttccttaagaaaagccatagaaacggtgtat
gcagcgtatttgcccaaaagcacacacccgttcctgtacctcagtctagaaatcagcccc
cagaatgtggacgtcaatgtgcaccccacgaagcacgaagttcacttcttgcacgaggag
agcatcctggagcggctgcagcagcacatcgaggacaggctcctgggctccaacgcctcc
aggacctacttcacccagactttattgccaggtcttactggcccctctggggaagcggta
aaatccacagcgaatgtgacatccccatccactgctggaagtggtgacagagtgtatgcc
caccagatggtccgcacagactgccgggaacagaagctcgatgccttcctgcagcctgtg
agcaaggccctgtccagtcagcccccggctgttgtcccagagcacaggacagatgcttct
agtagcggggccaggcagcaggatgaggagatgcttgaactcccagctcctgctgaagtg
gctgcgaagagtcaggccttagaggacgatgcaacaatgaggactgcagagctggccgag
aagagagggccctcttccagccccgagaaccccagaaagagacctcgggaagactctgat
gtggaaatggtggaggatgcgtcccgaaaggagatgacagctgcttgtacccccaggaga
aggatcatcaacctcaccagcattctgagtctccaggaggagattaccgagcggggacat
gagactctccgggagatgctgcataaccactcctttgtgggctgcgtgaatcctcagtgg
gccttggcacagcatcagaccaagttataccttctcaacaccaccagactcagtgaagaa
ctgttctaccagattctcatttatgattttgccaattttggtgttctgaggttatcggag
ccagcaccgctctttgacctggccatgcttgccttagacagtcccgagagtggctggaca
gaggaggatggtcccaaggagggacttgctgagtacattgtcgagtttctgaaaaagaag
gctgagatgcttgcagactacttctctctggagattgatgaggaagggaacctggttgga
ttaccccttctgatcgacaactatgtgcccccgctggagggtctgcctatcttcatcctc
cgactggccacagaggtgaactgggatgaagaaaaggaatgtttcgaaagcctcagtaaa
gagtgtgcgctgttttactccatccggaagcagtacgtgtctgcagagtcaaccctttca
ggccagcagagtgaagcgcctggctctactgcaaacccctggaagtggactgtggagcac
gtcatctataaagccttccgctcccacctactgcctccaaaacacttcacagaagatggg
aacatcctgcagcttgccaacctgcctgatctgtacaaagtcttcgagaggtgctga

DBGET integrated database retrieval system