KEGG   Ovis aries (sheep): 101108399
Entry
101108399         CDS       T03117                                 

Gene name
RFC3
Definition
(RefSeq) replication factor C subunit 3
  KO
K10756  replication factor C subunit 3/5
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101108399 (RFC3)
   03420 Nucleotide excision repair
    101108399 (RFC3)
   03430 Mismatch repair
    101108399 (RFC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101108399 (RFC3)
   03036 Chromosome and associated proteins [BR:oas03036]
    101108399 (RFC3)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101108399 (RFC3)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    101108399 (RFC3)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     101108399 (RFC3)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    101108399 (RFC3)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     101108399 (RFC3)
  Check point factors
   HRAD17(Rad24)-RFC complex
    101108399 (RFC3)
SSDB
Motif
Pfam: DNA_pol3_delta2 AAA Rad17 DNA_pol3_delta AAA_16 Rep_fac_C AAA_22 ABC_tran ATPgrasp_ST Sigma54_activ_2 CHB_HEX DUF2247 AAA_19 AAA_5 zf-HC2
Other DBs
NCBI-GeneID: 101108399
NCBI-ProteinID: XP_004012180
Ensembl: ENSOARG00000010697
LinkDB
Position
10
AA seq 356 aa
MSLWVDKYRPCSLGQLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELY
GVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQ
LETSSQKDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCL
AVRVPAPSIEDICHVLSTVCKKEGLNLPPQLAHRLAEKSCRNLRKALLMCEACRVQQYPF
TADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMIF
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgagcctctgggtggacaaataccggccctgctccttgggacagctggactatcacaag
gagcaggcggcccagctgcgcaacctggtacagtgtggtgactttccacatctgttagtg
tatggaccatcaggtgctggaaaaaagacaagaattatgtgtattctacgtgaactttat
ggtgttggagtggaaaaattgagaattgaacatcagaccatcacaactccatcgaaaaag
aaaattgaaattagcactattgcaagcaattatcaccttgaagttaatcctagtgatgct
ggaaatagcgatcgggtagtaattcaggagatgctgaaaacagtggcacaatcacagcaa
cttgaaacaagctctcaaaaagattttaaagttgtgttattgacggaagttgacaaactc
actaaagatgctcaacatgccttgcgcagaaccatggaaaagtatatgtctacctgcaga
ttgatcttgtgttgcaattctacatctaaagtgataccacctattcgtagtaggtgcctt
gcagttcgtgtacctgctcccagcattgaagatatttgccatgtgttatctactgtgtgt
aagaaggagggtctaaatcttcctccacaactggctcatagacttgcagagaagtcctgc
agaaatctcagaaaagctctgcttatgtgtgaagcctgcagagtgcaacaatatcctttt
actgcagatcaagaaatccctgaaacagattgggaggtgtatctgagagagactgccaat
gctattgtcagtcaacaaactccacagaggctccttgaagttcgtggaagactgtatgag
cttctaactcattgtattcctcctgaaataataatgaagggccttctctcagagctttta
cataattgtgatggacaactgaaaggagaagtggcccagatggcagcttactatgaacat
cgtctacaactcggtagcaaagccatttatcacttggaagcatttgtggccaaatttatg
gcactttataagaagttcatggaggatggattggaaggcatgatattctga

KEGG   Ovis aries (sheep): 101109450
Entry
101109450         CDS       T03117                                 

Gene name
RFC1
Definition
(RefSeq) replication factor C subunit 1 isoform X1
  KO
K10754  replication factor C subunit 1
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101109450 (RFC1)
   03420 Nucleotide excision repair
    101109450 (RFC1)
   03430 Mismatch repair
    101109450 (RFC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101109450 (RFC1)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101109450 (RFC1)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    101109450 (RFC1)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     101109450 (RFC1)
SSDB
Motif
Pfam: RFC1 BRCT AAA PTCB-BRCT AAA_22 RuvB_N AAA_5 Rad17 AAA_33 AAA_16 BRCT_2 AAA_7 Zeta_toxin AAA_14 RNA_helicase AAA_18 AAA_17 NTPase_1 AAA_30
Other DBs
NCBI-GeneID: 101109450
NCBI-ProteinID: XP_027826735
Ensembl: ENSOARG00000011358
LinkDB
Position
6
AA seq 1144 aa
MDIRKFFGVIPSGKKLVSETVKKNEKTKSAEESLKAKKGIKEIKVNNSRTEDEIKPKPSN
KKKRIIYDSDSESEETVQVKNAKKRPEKLPLSSKPAKIQQRDPVTYISETDEDDDFVCKK
TASKLKENGGSTNSYFGASNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSIQRSDKK
MVASRRKEPSQNADDSRLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKK
AEKAAEERETFSSVQVNLRKAEKPKYPHKEQFSDERKNFSPKKQTKCEGLRESQQRSRSS
AHKTGETSPKASSKLALLKKKEESSNKETESMASKRKENVIEFKETRTPKKIKSSPAKKE
SISPDDAEKRRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLTFVITGVLESIERDE
AKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTNIIDEDGLLNLIRTMPGK
KSKYEIAAEAEMKKEKSKLERTPQKNDQGKRKSSPTKKESESKKCKLTPKRESSIKSLKK
EASVSQRGLDFKEQAAEEADGDSRARNLADDSRESKVESLLWVDKYKPTSLKTIIGQQGD
QSCANKLLRWLQNWHKSPSEDKKHAAKFGKFAGKDDGSSFKAALLSGPPGVGKTTTASLV
CQELGYSYVELNASDTRSKNSLKEIVAESLNNTSIKGFYSSGTVHSVGTRHALIMDEVDG
MAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAM
MSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLNMWCARNKALTYDQAKADSHRAKKDV
KLGPFDVARKVFVTGEETAHMSLMDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGDMKKH
LMLLSRAADSICDGDLVDRQIRNKQNWSLLPTQAIYASVLPGELMRGYMTQFPTFPSWLG
KYSSMGKHDRTVQDLALHMSLRTYSSKRTVNMDYLSHLRDALVQPLASQGIEGVQDVVAL
MDAYYLMKDDFENIMEISNWGGRPSPFSKLDPKVKAAFTRAYNKEVHLTPYSLQAVKTHR
HSTGPSLDSEYSEELNEDDSQSDEKDQDTLETDAMIKKKTKSSKPSKSEKDKESRKGKGK
SSKK
NT seq 3435 nt   +upstreamnt  +downstreamnt
atggatattcgaaaattctttggggttataccaagtggaaagaaacttgtaagtgaaaca
gtaaagaagaatgagaaaacaaagtctgctgaagaaagtttaaaagcaaagaaaggaata
aaggaaatcaaggtaaataattctcgtacagaagatgaaatcaagccaaagccgtcaaac
aagaaaaagaggatcatctatgattcggattcagaatcagaggaaacagtacaggtaaaa
aatgccaaaaagcgaccagaaaaattgccactgtcttctaaacctgctaaaatccaacag
cgggatcctgttacctacatttcagaaacagatgaagatgatgactttgtgtgtaagaag
acagcctctaaattaaaagaaaatggaggatctacaaatagttattttggagcatcaaac
atgaaaaagaatgaggaaaacactaagaccaagaataagcctttgtcaccaataaaactt
acccccacatcagtgcttgattattttggaactggaagcatccaaagatcagataagaag
atggtggcaagcagaagaaaagagccttcacaaaatgcagatgattccagattaaatgat
gaagccatcgccaagcaattgcagcttgatgaagatgcagagctggagagacaactgcat
gaagatgaagagtttgctagaacgttagccatgttggatgaagaacccaagaccaaaaag
gctgaaaaggctgcagaagagagagagacgttttcatctgtacaagtcaatttacgtaaa
gcagagaaacctaaatatcctcataaagaacaattttcagatgaaagaaagaacttcagc
cctaagaagcaaactaagtgtgaaggtttaagagaatcccagcaacgttccaggtcatca
gctcataaaacaggagaaacttctccaaaagccagttctaagctggcacttttgaaaaaa
aaagaagagagttctaataaagaaacagagtctatggcctcaaaaagaaaagaaaatgtt
attgagtttaaagagacaagaactcctaagaaaatcaaaagttctccagctaaaaaagag
tctataagtcctgatgatgctgaaaagagacgcactaattatcaagcttaccgaagctac
ttaaatcgagaaggtcccaaagctctgggctccaaagaaataccaaagggagctgaaaat
tgcttggaaggccttacttttgtaatcacaggagtgctggagtccattgaacgagatgag
gccaagtctctaattgagcgttatgggggaaaagtgacgggaaatgtcagcaagaaaaca
aactacctggtcatgggtcgtgatagtggccaatccaagagtgacaaggcagcagccttg
ggaacaaatattattgatgaagatggcctgttgaatctgattcgaaccatgccaggcaag
aagtccaagtatgaaatagctgctgaagctgagatgaagaaagaaaaatccaaattggaa
agaacaccccaaaaaaatgaccaaggaaaaagaaaaagtagtccaactaagaaggaatca
gaatctaaaaagtgcaaactgactcccaaaagggaaagctctataaagtcactaaaaaag
gaagcaagtgtgtctcagagaggcctggacttcaaggagcaggcggctgaggaggcagat
ggtgacagccgggctaggaatttggctgatgacagcagagaaagcaaagtggaaagtttg
ctctgggtggataagtataagccaacctcgctcaagaccataattggacagcaaggtgac
cagagctgtgccaacaaactcctgcgctggctccaaaactggcacaagagtccatccgaa
gataagaaacacgcagcaaagtttggtaaatttgctggcaaagatgatgggtccagtttt
aaagcagcactgctctcaggtcctcctggtgttggcaaaacaaccacagcttctctggtt
tgtcaggaattggggtatagctatgtggaactgaatgcaagtgacactcggagtaagaac
agtttgaaggagattgttgctgagtcactgaataataccagcatcaaaggcttttattca
agtggaacagtccattcagtaggcacgaggcatgctctcatcatggatgaagtagatggc
atggctggcaatgaggacaggggaggaattcaggaattaattggcctgataaaacataca
aaaattcccattatttgtatgtgcaatgatagaaaccatcccaagattcgctctttggtt
cattattgttttgatcttcgttttcaaagacctcgggttgaacagattaagggtgcgatg
atgtctattgcatttaaagagggtctaaagatcccccctccagctatgaatgaaataatt
ttgggagctaatcaagatatcagacaggttttacacaatctgaatatgtggtgtgcacga
aataaggcactaacctatgaccaggccaaggctgattctcatagagccaaaaaggatgtc
aaactgggcccgtttgatgttgcccggaaagtgtttgtaactggagaagagactgctcat
atgtcacttatggacaagtcagatctcttcttccatgattattcaatagcacccctcttt
gtccaggagaactacatacatgtgaagcccgtagctgcagggggtgacatgaaaaagcac
ttgatgcttttaagcagagcagcagacagcatatgtgatggtgatctagtggaccgtcaa
atccggaataagcaaaactggagtcttctgcccacacaggccatttatgccagtgttctt
cctggagagttaatgagggggtacatgacccagtttcccaccttcccaagttggttgggg
aaatactcatctatgggcaaacacgatcgtactgttcaggacctggctctgcatatgagt
ctcagaacttactccagcaaaaggacggtaaacatggattatctgtcacatctaagggat
gcacttgtacagcccttggcctcacaagggatagaaggagtacaggatgttgttgctctc
atggatgcatattatttgatgaaagatgacttcgagaatattatggaaattagcaactgg
ggaggcagacctagtccgttttctaaactggatcccaaggtgaaagcagccttcacaaga
gcttacaataaagaagtccaccttactccgtattcactccaggcagtaaagacacacaga
catagcacaggcccatcactggattctgaatacagtgaagagttaaatgaagatgactct
caatctgatgagaaagaccaggacactttggaaactgatgctatgatcaagaaaaagaca
aaatcttcaaagccttcaaaatcagaaaaagataaggagtccagaaaaggaaaaggaaaa
agttcaaagaaatga

KEGG   Ovis aries (sheep): 101109740
Entry
101109740         CDS       T03117                                 

Gene name
RFC5
Definition
(RefSeq) replication factor C subunit 5 isoform X1
  KO
K10756  replication factor C subunit 3/5
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101109740 (RFC5)
   03420 Nucleotide excision repair
    101109740 (RFC5)
   03430 Mismatch repair
    101109740 (RFC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101109740 (RFC5)
   03036 Chromosome and associated proteins [BR:oas03036]
    101109740 (RFC5)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101109740 (RFC5)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    101109740 (RFC5)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     101109740 (RFC5)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    101109740 (RFC5)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     101109740 (RFC5)
  Check point factors
   HRAD17(Rad24)-RFC complex
    101109740 (RFC5)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_24 AAA_16 AAA_11 AAA_assoc_2 AAA_22 RuvB_N ResIII DUF815 AAA_19 AAA_14 AAA_5 DNA_pol3_delta DEAD PhoH AAA_30 TniB TIP49 AAA_7 T2SSE ATPase_2 IstB_IS21 Mg_chelatase AAA_25 AAA_3 SNF2_N
Other DBs
NCBI-GeneID: 101109740
NCBI-ProteinID: XP_011953232
Ensembl: ENSOARG00000003356
LinkDB
Position
17
AA seq 339 aa
METSAHKQQQPEAAKIRNLPWVEKYRPQTLDDLISHQDILSTIQKFISEDRLPHLLLYGP
PGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDIVRGPILSFASTRTIFKKGFKL
VILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPEL
MVPRLEHVVEEEKVDISEDGMKALITLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGH
PLKSDIANILDWMLNQDFTTAYRNIMELKTLKGLALHDILTEIHLFVHRVDFPSSVRIHL
LTKMADIEYRLSVGTSEKIQLSSLIAAFQVTRDLIVTEA
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggagacctcagcgcacaagcagcagcagcctgaggcggccaagatcagaaacctgccc
tgggttgaaaaataccggccacagacactggatgatctcatttctcatcaggacatcttg
agtactattcagaagtttatcagtgaggaccgcctgccgcacctccttctgtatggtcct
ccagggacaggaaagacatccaccatcctggcctgtgctaaacagctgtacaaagataag
gaatttggctccatggtcttggagctgaatgcttcagatgaccgaggaatagatattgtt
cggggaccaatcctgagctttgctagcacaaggacaatatttaagaaaggctttaaacta
gtgatcttggatgaggccgatgccatgactcaggacgcccagaacgccctgcggagagtg
attgagaagtttactgaaaataccagattttgcctcatctgtaactatctgtcaaagatc
attcccgccttgcagtcccggtgtacaagattccgatttggaccactgactcccgaactc
atggttccccgcctggaacacgtcgtagaagaagagaaagttgatataagtgaagatggg
atgaaagcgctcataactctttccagtggagacatgcgaagggctctgaacatcttacag
agcaccaacatggcctttgggaaggtcacagaggagaccgtctacacctgcacaggacac
ccactcaagtcagacatcgccaacatcctggactggatgttgaatcaagacttcaccacg
gcctacaggaatatcatggagttaaaaactctgaagggattggcgttacacgacatcctg
acggagatacacctgttcgtgcacagagttgactttccatcttcagttcgaatacattta
ttgaccaaaatggcagacattgagtacagactttctgttggcaccagtgagaagattcag
ctgagttccctcattgccgcttttcaagtcaccagagacctgattgtcactgaggcctag

KEGG   Ovis aries (sheep): 101110382
Entry
101110382         CDS       T03117                                 

Gene name
RFC2
Definition
(RefSeq) replication factor C subunit 2 isoform X1
  KO
K10755  replication factor C subunit 2/4
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101110382 (RFC2)
   03420 Nucleotide excision repair
    101110382 (RFC2)
   03430 Mismatch repair
    101110382 (RFC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101110382 (RFC2)
   03036 Chromosome and associated proteins [BR:oas03036]
    101110382 (RFC2)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101110382 (RFC2)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    101110382 (RFC2)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     101110382 (RFC2)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    101110382 (RFC2)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     101110382 (RFC2)
  Check point factors
   HRAD17(Rad24)-RFC complex
    101110382 (RFC2)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 AAA_14 AAA_16 AAA_22 AAA_24 Viral_helicase1 Mg_chelatase AAA_11 Rad17 AAA_assoc_2 RuvB_N AAA_18 AAA_19 AAA_5 MipZ AAA_25 DEAD T2SSE ABC_tran DNA_pol3_delta AAA_30 AAA_28 NTPase_1 FtsK_SpoIIIE MeaB AAA_23 DUF815 RNA_helicase
Other DBs
NCBI-GeneID: 101110382
NCBI-ProteinID: XP_027816931
LinkDB
Position
24
AA seq 352 aa
MESQESRGGTAECGAQDAAPGPSKAPGSAGHYELPWVEKYRPVKLNEIVGNEDTVSRLEV
FAREGNVPNIIIAGPPGTGKTTSILCLARALLGPALKDAVLELNASNDRGIDVVRNKIKM
FAQQKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQ
SRCAVLRYTKLTDAQILARLLSVIEKEKVQYTDDGLEAIIFTAQGDMRQALNNLQSTYSG
FGFINSENVFKVCDEPHPLLVKEMIQHCVSADIDEAYKILAHLWHLGYSPEDIISNIFRV
CKTFQMAEYLKLEFIKEIGYTHMKIAEGVNSLLQMAGLLARLCQKTMAPVAS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggagtcgcaggagagtcgtggtggcactgccgagtgcggggcccaggacgctgctcca
ggccccagcaaggcccccggcagcgccggccactacgagctgccgtgggttgaaaaatac
agaccagtgaagttgaatgaaattgtcgggaatgaagacaccgtgagcaggctggaggtc
tttgcaagggaagggaacgtgcccaacatcattatcgctggccccccgggaaccggcaag
accaccagcatcttgtgtttggcacgagccctgctgggcccagccctcaaggatgcggtt
ttggagctcaatgcctcaaacgacaggggcatcgatgttgtgaggaacaaaatcaaaatg
tttgcccagcagaaagtcaccctgcccaaaggacggcacaagatcatcatcctggatgaa
gcagacagcatgactgacggagcccagcaagccttgaggaggaccatggagatctactcc
aagacgacccgctttgctctcgcttgtaacgcttcagataaaatcatagagcccattcag
tcccggtgtgccgtcctccgctacacgaagctgaccgacgcgcagattcttgccaggctc
ctgagcgtcattgagaaggagaaggtccagtacacggatgacggcctggaagccatcatc
ttcaccgcccagggcgacatgaggcaggccttgaacaacttgcagtctacttactcggga
tttggcttcatcaacagtgagaatgtgttcaaggtctgtgacgagccccaccccttgctg
gtaaaggagatgatccagcattgtgtgagcgccgacatcgacgaggcctacaagatcctt
gctcacctgtggcatcttggctattccccagaagacatcatcagcaacatttttcgagtg
tgtaaaaccttccagatggcagaatacttgaaactggagtttatcaaggaaattggatac
acgcatatgaaaatagcggaaggtgtgaactcccttctgcagatggcagggctcctggcc
aggctgtgtcagaagacaatggccccagtggccagttag

KEGG   Ovis aries (sheep): 101112103
Entry
101112103         CDS       T03117                                 

Gene name
RFC4
Definition
(RefSeq) replication factor C subunit 4
  KO
K10755  replication factor C subunit 2/4
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03420  Nucleotide excision repair
oas03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101112103 (RFC4)
   03420 Nucleotide excision repair
    101112103 (RFC4)
   03430 Mismatch repair
    101112103 (RFC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101112103 (RFC4)
   03036 Chromosome and associated proteins [BR:oas03036]
    101112103 (RFC4)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101112103 (RFC4)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RFC (replication factor C)
    101112103 (RFC4)
  DNA Replication Termination Factors
   Other telomere regulation proteins
    ELG1-RFC complex
     101112103 (RFC4)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   CTF18-RFC complex
    101112103 (RFC4)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    RFC (replication factor C)
     101112103 (RFC4)
  Check point factors
   HRAD17(Rad24)-RFC complex
    101112103 (RFC4)
SSDB
Motif
Pfam: Rep_fac_C AAA DNA_pol3_delta2 Rad17 AAA_16 AAA_assoc_2 DUF815 AAA_24 AAA_11 AAA_22 AAA_30 AAA_19 DNA_pol3_delta Mg_chelatase RuvB_N AAA_5 ResIII Viral_helicase1 AAA_23 AAA_28 AAA_7
Other DBs
NCBI-GeneID: 101112103
NCBI-ProteinID: XP_004003103
Ensembl: ENSOARG00000020512
LinkDB
Position
1
AA seq 364 aa
MQAFLKGASISTKPPPTKDRGVTATARSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVA
VLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
NYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIADKEHVKISNEGIAYLVKVSEGDLRK
AITFLQSATRLTGGKEVTEKVITDIAGVVPAKTIDGVFAACQSGSFDKLEAVVKDLINEG
HAATQLVNQLHDVVVENDNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQL
TQNC
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgcaggcatttctaaaaggcgcatctatcagcactaaaccaccgccgactaaggatcga
ggagtaactgccactgccagaagtagtggagagaacaagaaagccaaacctgttccgtgg
gtggaaaaatatcgcccaaaatgtgtggatgaagttgctttccaggaagaagtggttgca
gtccttaaaaagtctttagaaggagctgatctccctaatctcttattttatgggccacct
ggaactggaaaaacatcaactattttggcagcagctagagaactcttcgggcctgaactt
tttcgattaagagttcttgagttaaatgcatctgatgaacgtggaatacaagtagttaga
gagaaagttaagaattttgcccaattaactgtgtcaggaagccgttcagatggaaagcca
tgtcctccttttaaaattgtgattctggatgaagcagattctatgacctcagctgctcag
gcagctctaagacgtaccatggagaaagagtctaaaaccacccgattctgtctcatctgt
aactatgtcagccgaataattgaacctctgacctctagatgttctaaattccgcttcaaa
cctctgtcagataaaattcagcagcagcggttactagacatcgctgataaagaacacgtc
aaaattagcaatgagggaatagcttatcttgttaaagtgtcagaaggagacttaagaaaa
gccattacatttcttcaaagtgctactcgtctgactggtggaaaggaagtcacagaaaaa
gtgatcacagatattgctggggtagtaccagctaagacaattgacggagtatttgctgcc
tgtcagagtggctctttcgacaaactagaagctgtggtaaaggatttaataaatgagggc
catgcagcaactcaacttgtaaatcaactccatgatgtagtggtagaaaatgataacctt
tctgataaacagaagtctattattacagaaaaacttgctgaagttgataaatgcttagca
gacggcgctgatgaacatctgcagctgatcagcctctgtgctactgtgatgcagcagtta
actcagaattgctaa

DBGET integrated database retrieval system