KEGG   Ovis aries (sheep): 101108908
Entry
101108908         CDS       T03117                                 

Gene name
SSBP1
Definition
(RefSeq) single-stranded DNA-binding protein, mitochondrial
  KO
K03111  single-strand DNA-binding protein
Organism
oas  Ovis aries (sheep)
Pathway
oas03030  DNA replication
oas03430  Mismatch repair
oas03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101108908 (SSBP1)
   03430 Mismatch repair
    101108908 (SSBP1)
   03440 Homologous recombination
    101108908 (SSBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101108908 (SSBP1)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101108908 (SSBP1)
   03029 Mitochondrial biogenesis [BR:oas03029]
    101108908 (SSBP1)
DNA replication proteins [BR:oas03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    101108908 (SSBP1)
DNA repair and recombination proteins [BR:oas03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     101108908 (SSBP1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    101108908 (SSBP1)
Mitochondrial biogenesis [BR:oas03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    101108908 (SSBP1)
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-GeneID: 101108908
NCBI-ProteinID: XP_004008166
Ensembl: ENSOARG00000014046
LinkDB
Position
4
AA seq 148 aa
MFRRPVVQVLRQFVRHESEVASSLVLERSLNRVQLLGRVGQDPVMRQVEGKNPVTIFSLA
TNEMWRSGENETYQMGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYVEGKVDYGEYT
DKNNVRRQATTIIADNIIFLTDQMKEKP
NT seq 447 nt   +upstreamnt  +downstreamnt
atgtttcgaagacctgtagtacaggtacttcgtcagtttgtaagacatgagtctgaagta
gctagcagtttggttctcgagagatctctgaatcgcgtgcagttgcttggtcgagtaggt
caggaccctgtcatgagacaggtagaaggaaaaaacccagtcacgatattttccctagca
acaaacgagatgtggcgatcaggggaaaacgaaacctaccaaatgggtgatgtcagtcag
aagacaacatggcatagaatctcagtgttccgaccgggcctcagagatgtggcgtatcag
tacgtgaagaaggggtctcgaatttatgtggaagggaaagtagactatggtgaatatacg
gataaaaacaatgtgagacgacaagcaacaacaattatagctgataatattatatttctg
actgaccagatgaaagagaagccgtag

DBGET integrated database retrieval system