KEGG   Ovis aries (sheep): 101109183
Entry
101109183         CDS       T03117                                 

Gene name
MLH3
Definition
(RefSeq) DNA mismatch repair protein Mlh3 isoform X1
  KO
K08739  DNA mismatch repair protein MLH3
Organism
oas  Ovis aries (sheep)
Pathway
oas03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101109183 (MLH3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101109183 (MLH3)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     101109183 (MLH3)
SSDB
Motif
Pfam: DNA_mis_repair MutL_C HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 101109183
NCBI-ProteinID: XP_012037446
Ensembl: ENSOARG00000001619
LinkDB
Position
7
AA seq 1463 aa
MIKCLSAEVQAKLRSGLAVCSLGQCVEELALNSIDAEAKCVAVRVNMETFQVQVIDNGFG
MGSDDVDKVGNRYFTSKCNSVQDLENPRFYGFRGEALASIADMASAVEISSKKNKSMKTF
VKLFQNGKALKACEAAFTRPSTGTTVTVYNLFYQLPVRRKCMDPRLEFEKVRQRIEALSL
MHPSISFSLRNDVSGSMVLQLPKTKDICSRFCQIYGLGKSQKLREINFKYKEFELTGFIS
SEAHYNKNMQFLFVNKRLVLRTKLHKLIDFLLRKESIICKPKSGSASRQMNSSPRPRSNP
ELHGIYVINVQCQFCEYDVCLEPAKTLIEFQNWDTLLVCIQEGVKMFLKKEKLFVELSSE
DIKEFSEDNDFSLFSASLQKQVSSDEKCGRVSFQEACNNILDSYEMFNLQSKAVKRKAPV
ENISTHNSRDSETIRKKTNDSFLYTYKSDGPAHYKMAESSLQNEDSACSHSRNLEQDTAG
ASESGENKKHKKSCLEHNSSENPCGTSSEMCGSPFQTLYHFEGSGEDLEIQKVSTAVNSM
AANILENNRIQNQPERYKDATEMKCQPLSFETALSGEPSAQREEEKRKKPSACGRINVFH
YGQVKLCSTGFITHVVQSEQTKSTETEHLFKSYAQPGPVSAKETFRNRTHHSVKILNSKD
LTSTLSKEFAQLPNKSLCSTDRSYELENKHTAAYKNFAIFQESSKKSHTGGLLLDTSSFS
WGRHVSDGSKKTDKLIGPAKPIPHKKLSLSSQLGSLEKFKRQYGKVKNPLNTEVEENNTL
EITTNLSPQVEADIPWKDKNHLDNSDICEITTMKYNDSNSSCQPVNHMFSSEKFPFSKED
HCLEQQMLCLTESTVTLQELPHFNSKFLDVEKSPESLASKLSRLKDSERETPRMDVSHFN
ELPQLDSSRKDGDLSSGLTLDSCKLFKNEHKKPESDNIPMSDSVTQSNLFSKDSETYSNN
NTTEKIPGNPLVLPYDHATVISKDSDVLIASKQQIGSPFSMSRMLMSRMEDSTADQNGTC
FQSEESIAIARTCSENEGSNICSLDWQQHFDVTLGRMVYINKLTGLSTFTAPTEDVRAAC
TKDLTTMAVDVLLENGSQYRCHPFRSDLVLPFLPRAREERTVMRQNNRATGDDAFGPESL
QSLFSEWDNPIFARYPEVAVDVSSGQAESLAVKIHNILYPYRFTKEMIHSMQVLQQVDNK
FIACLMSTKTEENGEAGGNLLVLVDQHAAHERVRLEQLIIDSYEKQQPQGFGRKKLLSSI
VSPPLEITVTEEQRRLLRCYHKNLEDLGLEIVFPDTSDSLVLIGKVPLCFVEREANELRR
GRSTVTKGIVEEFIREQVELLQTTGGIQGTLPLTVQKVLASQACHGAIKFNDGLSFEESC
RLIEALSWCQLPFQCAHGRPSMLPLANIDHLEQEKQTKPNLAKLRRMAQAWHLFGKGEGC
DVGQGLQASMPPCELPREQNYSL
NT seq 4392 nt   +upstreamnt  +downstreamnt
atgatcaaatgcttgtcagctgaagtacaagctaaattgcgttctggtttggctgtatgc
tccttaggccaatgtgttgaggagcttgccctcaacagtattgatgctgaagcaaaatgt
gtggctgtcagggtgaacatggaaaccttccaagttcaagtgatagacaatggatttggg
atggggagtgatgatgtagacaaggtgggaaatcgttatttcaccagtaaatgcaactct
gtacaagacttggagaacccaaggttttatggtttccggggggaggcgttggccagtata
gcagatatggccagtgctgtggaaatttcatccaagaaaaacaagtcgatgaaaacattt
gtgaaactgtttcagaatgggaaagccctgaaagcttgtgaagctgccttcactcgacca
agtaccgggacaacagtcactgtatataatctgttttatcaattacctgttaggaggaaa
tgcatggatcctagactggagtttgagaaggttaggcagaggatagaagctctgtcactc
atgcacccttccatttctttctctttgagaaatgatgtttctggttccatggttcttcaa
ctccctaaaacgaaagacatatgttcccgattttgtcaaatttatggactgggtaagtcc
caaaagttaagagaaataaattttaaatataaggagtttgagcttactggctttatcagc
tctgaagcacattataataagaatatgcagtttttgtttgtgaacaagaggttagtttta
aggacaaagttgcataaactcattgactttttattaaggaaagaaagtattatatgcaaa
ccaaagagtggttctgccagtaggcaaatgaattcaagtcctcggcctaggtctaacccg
gaactccatgggatctacgtaatcaatgtgcagtgccagttctgtgagtatgacgtgtgc
ctggagccagcaaaaaccctgattgagtttcagaactgggatactcttttggtttgcatt
caggaaggagtaaaaatgtttttaaagaaagaaaaattatttgtggaattatcaagtgaa
gacattaaggaatttagtgaagataatgattttagtttattcagtgccagtcttcagaag
caagtgtcctctgatgagaagtgtggccgggtcagtttccaagaagcatgtaataatatt
ttggattcctatgagatgttcaatttgcagtcaaaagctgtgaaaagaaaagctcctgta
gaaaacataagcacacataattctagggattcggaaactatcagaaaaaagacaaatgat
tcatttttgtacacttacaaatccgatgggccagcccattataaaatggcagagtcatct
ttgcaaaatgaagacagtgcttgctcacactcaaggaacttagaacaagacacagctgga
gcatcagaatcaggagaaaataagaaacataaaaaatcttgcttggaacataactcttca
gaaaatccatgtggaaccagttcagaaatgtgtggaagcccttttcagacattatatcac
tttgaggggagtggagaagatctagaaatacaaaaagtaagtactgctgttaatagcatg
gctgccaacatcctggaaaataacagaattcagaatcaaccagagagatataaagatgct
actgaaatgaaatgccaacctctgtcttttgagacagcattatcaggagaacctagtgct
cagagagaggaagagaaaagaaaaaaacctagtgcttgtggaagaataaatgtttttcat
tatggacaagttaaattatgttctactggcttcataactcatgtggtacagagtgagcaa
actaaatcaactgaaacagaacatttatttaaaagttatgctcaacctggtcctgtgagt
gccaaagaaacatttagaaatagaacacaccattcagttaagattctaaacagcaaagat
ttaaccagcactttaagtaaagaatttgctcaactgcccaacaaaagtctgtgcagcaca
gatcgaagttatgagctagagaacaaacatacagcagcttataaaaattttgctattttt
caggaaagtagtaaaaaatcacacacaggtggcttattactcgacacatcctctttctct
tggggtagacatgtttcagatggtagtaagaaaaccgacaagttgattggtcctgccaaa
cccatacctcataagaagctaagcttaagttcacaactaggatctttagagaagtttaag
aggcaatatgggaaggttaaaaatcctctcaatactgaagtggaggaaaataatacttta
gaaatcactaccaatctcagtcctcaagttgaagctgacattccatggaaagacaaaaac
cacttagacaactctgacatctgtgaaatcactactatgaaatataatgattccaatagt
agttgtcaaccagtaaatcacatgttttcttcagaaaagtttccattctccaaggaagat
cattgtttggaacaacagatgctttgcttaacagaaagtactgtaactctacaggagtta
cctcattttaacagtaaatttttggatgttgagaagtcacctgaatcactagcctctaaa
ttatccagattgaaggattccgaaagagagactccaaggatggatgtaagtcattttaat
gaattgccacaattagattccagtaggaaagatggtgacttgtccagtgggttaacccta
gattcttgtaagttatttaaaaatgagcataaaaaaccagaaagtgacaacatcccaatg
tcagactctgtcacacaaagtaatctcttcagtaaagacagtgaaacatattctaacaac
aataccactgagaagataccaggaaatcctttggttctgccctatgaccatgctacagtt
atcagtaaggattcagatgttcttatagcttcaaaacaacagattggaagtcctttctct
atgagcagaatgttaatgagtcgcatggaagattccacagctgaccaaaatggaacttgt
tttcagagtgaggaatccatagccatagcaagaacttgttctgaaaatgaagggtccaac
atatgttctttggattggcagcagcattttgatgtaactctgggaagaatggtttacatc
aacaaactaacaggacttagcacgttcactgctcctactgaggatgttcgggccgcttgt
actaaagacctgacaactatggctgtggatgtgctactggagaacggatctcagtacagg
tgtcatccctttagaagcgaccttgttcttcctttccttcctagagctcgggaagagagg
actgtgatgagacagaataacagagctactggggacgatgcctttggtcctgaatcgctt
cagtctttgttctcagaatgggacaatccaatatttgcccgttatccagaggttgctgtt
gacgtaagcagcggccaagctgagagcctagcagttaaaattcacaacatcttgtatcct
tatcgtttcaccaaagaaatgattcactcaatgcaggttctccagcaagtggataacaag
tttattgcctgtttaatgagcactaagactgaagagaatggtgaggcaggtggaaacctg
ctagtcttggtggaccagcacgctgcccacgagcgcgtccgactggagcagctgatcatt
gattcctatgagaaacaacagccacaaggctttggtcgaaaaaaattactgtcttccatc
gtaagtcctccactagagataacagtgacagaggaacaaaggagactcttacggtgttac
cacaaaaatctggaagatctgggccttgaaattgtatttccagacaccagtgattcactg
gtcctcataggaaaagtaccactctgttttgtagaaagagaagccaatgaacttcgaaga
ggaagatctactgtgaccaagggcattgtggaggagtttattcgagaacaagtggagcta
ctccagaccacaggaggcatccaagggactttaccactgaccgtccagaaggtgttggca
tcccaagcctgccatggggccattaagtttaatgatggcctgagcttcgaggagagctgt
cgccttattgaagcgctatcctggtgccagctgccgttccagtgtgctcatggcaggccc
tccatgctgccattagctaacatcgaccacttggagcaggaaaaacagactaaacccaat
cttgctaaacttcgcagaatggctcaggcctggcatctctttggaaaaggagaaggatgt
gatgtagggcaaggcctgcaggcatccatgcctccttgtgagctgccaagagagcagaat
tactctctgtaa

DBGET integrated database retrieval system