KEGG   Ovis aries (sheep): 101109230Help
Entry
101109230         CDS       T03117                                 

Gene name
SETDB1
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB1 isoform X1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
oas  Ovis aries (sheep)
Pathway
oas00310  Lysine degradation
oas04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101109230 (SETDB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101109230 (SETDB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:oas03036]
    101109230 (SETDB1)
Enzymes [BR:oas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101109230 (SETDB1)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101109230 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101109230 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET DUF5604 Tudor_4 TUDOR_5 Pre-SET MBD DUF4537 Chromo
Motif
Other DBs
NCBI-GeneID: 101109230
NCBI-ProteinID: XP_027830304
Ensembl: ENSOARG00000020880
LinkDB All DBs
Position
1
AA seq 1287 aa AA seqDB search
MSSLPGCIGLAAATAAVESEEIAELQQSVVEELGISMEELRQFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDEASRPT
EIIEIPDEDDDVLSIDSGDAGNRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMPGELSKDGDLVVSMRILGKKRTKTWHKGTLIAIQTVGSGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYITAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTSTGTQFKPTEPPQPTAPPAPPGPALSPQAGDSESLEGQLA
QSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENAPGGKPGINQTYRSPLGSTTSAPAPPA
PPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRSEQYRGKNPLLVPL
LYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCLDPYV
LVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFINTGPE
FLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVYECNKR
CKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADK
EGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEESNDD
SSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSEMSSKDSRPPDLGPPHIPVPPSIP
VGGCNPPSSEETSKNKVASWLSCNSISEGGFADSDSRSSFKTSEGGEGRTGGGRGEAEKA
STSGLGFKDEGDIKQAKKEDPDDRNRMSLVTESSRNYGYNPSPVKPEGLRRPPSKTSMHQ
SRRLMASAQPNPDDILTLSSSTESEGESGTSRKPTAGQTSATAMDSDDIQTISSGSEGDD
FEDKKNMSGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVEKGESAPVRKNTRQFYDGE
ESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWD
YNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3864 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccctccctgggtgcattggtttggcagcagcaacagcagcagtggagtctgaa
gaaattgcagagctgcaacagtcggtggttgaggagctgggtatctcaatggaggagctt
cgacagttcattgatgaagaactggaaaagatggactgtgtacagcagcgcaagaagcaa
ctagcagagttggagacttgggtaatacagaaggaatctgaggtggcccatgttgaccaa
ctctttgatgatgcatccagggcagtgactaactgtgagtctttggtgaaggacttttat
tccaaactgggactacagtaccgggacagcagctctgaagatgaagcttcccggcctaca
gaaataattgagattcctgatgaagacgatgatgtcctcagtattgattcaggtgatgct
gggaacagaactccaaaagaccagaagctccgtgaagctatggctgccttaagaaaatcg
gctcaagatgtccagaagttcatggatgctgtcaacaagaagagtagttcccaggatctt
cacaaaggaaccttgagccagatgcctggagaactgagcaaagatggtgacttggtcgtc
agcatgcgcatcctcggcaaaaaaagaactaagacgtggcacaaaggcacccttattgcc
atccagacggttgggtcaggaaagaagtacaaggtgaaatttgacaacaaaggaaagagt
cttctgtcaggaaaccacattgcctacgattaccaccctcctgctgacaagttgtatgtg
ggcagtcgagtagtggccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcatcttctttgatgatggc
tatgcttcctatgttacacagtctgaactatatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgccgagacttcatagaagagtatatcaccgcttac
cccaaccgccccatggtgttgctcaagagtggccagctgatcaagactgagtgggaaggc
acgtggtggaagtcccgagtcgaggaggtggacggcagcctagtcaggatcctctttctg
gatgacaaaagatgtgaatggatctatcgaggctctacacgactggagcccatgttcagc
atgaagacatcatccgcctctgcactagagaagaagcaagggggacagcttagaacacgt
ccaaatatgggtgctgtgagaagcaaaggtcctgtggtccagtacactcaggatctaaca
agtactggaacccagttcaagcctacggaacccccacagccgacagccccacctgcccca
cctggtccagctctgtccccccaggcaggtgacagtgaaagcttggaaggccagcttgcc
caatctcggaagcaggtagccaaaaaaagcacatctttccggccaggatctgtgggctct
ggtcattcctcccctacatcccctgcactcagtgaaaatgcccctggtgggaaacctggg
atcaatcagacatataggtcacctttaggctccacaacctctgccccagctcccccagct
cccccagcacccccagccttccatggcatgctggagcgggcccctgcagagccctcctac
cgtgcccccatggagaagcttttctacttacctcatgtctgcagctatacttgtctgtct
cgagtcagacctatgagaagtgagcagtatcggggcaagaaccctctgttagtcccacta
ctctatgacttccggcggatgacagcccggcgccgggtcaaccgcaagatgggcttccat
gttatctacaagacaccctgtggcctctgccttcggacaatgcaggagatcgagcgttac
ctttttgagactggctgtgacttcctcttcctggagatgttctgtttggatccgtatgtt
cttgtggaccgaaagtttcagccctataagcctttttactatattttggacatcacctat
gggaaggaagacgttcctctatcctgcgttaacgagattgacacaactcccccaccccag
gtggcctacagcaaggaacggatcccgggcaagggtgttttcattaacacaggccctgag
tttcttgtcggctgtgactgcaaagatgggtgccgggacaagtccaagtgtgcctgccat
cagctaactatccaggctacagcctgcaccccaggaggccaaatcaaccccaactctggc
taccaatacaagagactagaagaatgtctgcccacaggagtttatgagtgtaacaaacgc
tgcaaatgtgaccctaacatgtgcacaaaccggttggtacagcatggcctgcaagttcgt
ctgcagctcttcaagacccagaacaagggctggggtatccgttgcttggatgatattgcc
aaaggctcctttgtctgtatttatgcagggaagatcctgacagatgactttgctgacaag
gagggcctagaaatgggtgatgagtactttgccaatctggaccatattgagagcgtggag
aacttcaaggaggggtatgagagtgatgccccctgttcctctgacagcagtggtgtagac
ttgaaggaccaggaagatggcaacagcggtacagaggaccccgaggagtccaatgacgac
agctcagatgacaatttctgtaaggacgaggacttcagcaccagctcggtgtggcgcagc
tatgctacccgacggcagacccggggccagaaggagaatggattgtctgagatgtcttcc
aaggactctcgccccccagacctagggcccccacatattcctgtccctccatcaatccct
gtaggtggctgcaatccaccttcctctgaagagacatctaagaacaaagtggcctcgtgg
ttgagctgcaacagtatcagtgaaggtggctttgctgactctgatagccgttcatccttc
aagactagtgaaggtggggaaggccgcactgggggaggcagaggggaagctgagaaggct
tccacctcagggctgggcttcaaggatgagggagacatcaagcaggccaagaaagaggac
cctgatgaccgaaacaggatgtcgctagtgactgaaagctctcgaaattatggttataat
ccttctcctgtgaagcctgaaggacttcgccgcccaccaagtaagactagtatgcatcag
agccgacgactcatggcctctgctcagccaaaccctgatgatatcctgaccctgtccagc
agcacagaaagtgagggggaaagtgggaccagccggaagcccactgctggccagacttca
gccacagccatggacagtgatgatatccagaccatctcctctggctctgaaggggatgac
tttgaggacaagaagaacatgtctggtccaatgaagcgccaagtggcagtaaagtccacc
cggggttttgctttgaaatcaacccatgggattgccattaaatcaaccaacatggcatcc
gtggaaaagggggagagtgcacccgttcgtaagaacacacgccagttctacgatggggag
gagtcttgctacatcatcgatgccaagcttgaaggcaacctgggccgctacctcaatcac
agttgcagccccaacctgtttgtccagaatgtcttcgtggatactcatgatctccgcttc
ccgtgggtggccttctttgccagcaagagaatccgggctggcaccgagctcacctgggac
tacaactatgaggtgggcagcgtggagggcaaggagctgctttgctgctgcggggccatc
gaatgccgagggcgtcttctttag

DBGET integrated database retrieval system