KEGG   Ovis aries (sheep): 101109353
Entry
101109353         CDS       T03117                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04390  Hippo signaling pathway
oas04810  Regulation of actin cytoskeleton
oas05200  Pathways in cancer
oas05218  Melanoma
oas05224  Breast cancer
oas05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101109353 (FGF1)
   04014 Ras signaling pathway
    101109353 (FGF1)
   04015 Rap1 signaling pathway
    101109353 (FGF1)
   04390 Hippo signaling pathway
    101109353 (FGF1)
   04151 PI3K-Akt signaling pathway
    101109353 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101109353 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101109353 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    101109353 (FGF1)
   05218 Melanoma
    101109353 (FGF1)
   05224 Breast cancer
    101109353 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:oas04052]
    101109353 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:oas00536]
    101109353 (FGF1)
Cytokines and growth factors [BR:oas04052]
 Growth factors
  Growth factors (RTK binding)
   101109353 (FGF1)
Glycosaminoglycan binding proteins [BR:oas00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   101109353 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 101109353
NCBI-ProteinID: XP_004008958
Ensembl: ENSOARG00000001851
UniProt: Q7M303
LinkDB
Position
5
AA seq 155 aa
MAEGETTTFRALTEKFNLPLGNYKKPKLLYCSNGGYFLRILPDGRVDGTKDRSDQHIQLQ
LYAESIGEVYIKSTETGQFLAMDTNGLLYGSQTPSEECLFLERLEENHYNTYISKKHAEK
NWFIGLKKNGSSKLGPRTHFGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggctgaaggagaaaccacaaccttcagggccctgactgagaagtttaacctgcctcta
ggcaattacaagaagcccaagctcctctattgcagcaacgggggctacttcctgagaatc
ctcccagatggcagagtggatgggacgaaggacaggagcgaccagcacattcagctgcag
ctctatgcggaaagcataggggaggtgtatattaagagtacggagactggccagttcttg
gccatggacaccaacgggcttttgtacggctcacaaacacccagtgaggaatgtttgttc
ctggaaaggctggaggaaaaccattataacacctacatatccaagaagcatgcagagaag
aattggttcattggtctcaagaagaacggaagctccaaactcggtcctcggactcacttc
ggccagaaagccatcttgtttctccccctgccagtttcctctgattaa

DBGET integrated database retrieval system