KEGG   Ovis aries (sheep): 101109586Help
Entry
101109586         CDS       T03117                                 

Gene name
WBSCR17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
oas  Ovis aries (sheep)
Pathway
oas00512  Mucin type O-glycan biosynthesis
oas01100  Metabolic pathways
Module
oas_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101109586 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:oas01003]
    101109586 (WBSCR17)
Enzymes [BR:oas01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101109586 (WBSCR17)
Glycosyltransferases [BR:oas01003]
 O-Glycan biosynthesis
  Mucin-type
   101109586 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin
Motif
Other DBs
NCBI-GeneID: 101109586
NCBI-ProteinID: XP_014959391
LinkDB All DBs
Position
24
AA seq 812 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPISVRSGDSFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPMENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNAKSRLPQLLD
CDKVKSSLYKRWNFIQVSPPRTAASHTSLLSPQLARYTKEGFLHLGALGTTTLLPDTRCL
VDNAKSRLPQLLDCDKVKSSLYKRWNFIQNGAIMNRGTGRCLEVENRGGPAMLWTSHTGR
ETARHRGVLSGASPGQPGAPGGDSASSSGIQLSEAHAPWERPLTLLWEPRSRVFCSPDVD
LVPRSNTSHLLLGIFPPAVRTGLAEAPPFSHLPSTKGSGLGHILAPPPPRRQQGPGTQFP
PGCLCPDAHLQPKITTPNLSSRWPWTSLDSHP
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgttggtgttgaacttgatcgcggtggccggc
ttcgtgctcttcttggccaagtgccggcccatctcggtgcgcagcggagactccttccat
gagattcggccgcgggccgaggccgctaaccttagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctctcgctgctcgaggacattgtctaccggcaactaaacggt
ttatccaaatcccttgggctcattgaaggttatggtgggcggggaaaaggaggccttcct
gccaccctttcccctgctgaagaagaaaaagccaagggaccccatgagaagtatggctac
aattcctacctcagtgaaaaaatttcactggatcgttccattccggattatcgtcccacc
aagtgtaaggagctgaagtactccaaggagctgccccagatatccatcatatttatcttc
gtgaacgaggccctgtcggtgatcctgcgctcagttcacagcgcggtcaaccacacgccg
acccacctgctgaaggaaatcatcctagtggatgacaacagtgacgaagaggagctgaag
gcccccttggaggagtatgtccacaaacgctaccccgggctggtgaaggtggtgagaaac
cagaaaagagagggactgatccgagctcgtattgagggctggaaggtggccactggccag
gtcaccggcttctttgatgcccacgtggagttcaccgctggctgggccgaaccggtcctc
tcgcggatccaggagaaccggaagcgtgtgatccttccctccattgacaacatcaagcag
gacaccttcgaggtgcagcggtatgagaactcggcccacgggtacagctgggagctgtgg
tgcatgtacatcagccccccgaaagactggtgggacgccggagacccttccctccccatc
aggacaccagccatgatcggctgctcgtttgtggtcaacaggaagttctttggtgaaatc
ggtcttctggaccctgggatggatgtgtatggaggagaaaatatcgaacttggaatcaag
gtgtggctgtgtgggggcagcatggaggtcctgccttgctcacgggtggcccacatcgag
cggaagaagaagccatacaacagcaacatcggcttctacaccaagaggaacgctctacgg
gttgccgaagtctggatggacgactacaagtctcacgtgtacatagcgtggaatctgccg
ctagagaatccaggaattgacattggcgatgtctctgaaagaagagccttaaggaaaagt
ttaaagtgtaagaatttccagtggtatctggaccacgtctacccagaaatgcgaagatac
aataacaccgttgcctacggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
caggggccaatggagaaccacacggcaatactatacccgtgccacggctggggaccccag
ctggctcgctacaccaaggagggcttcctgcacttgggcgccctggggaccaccacgctc
ctccctgacacccgctgcctggtggacaacgccaagagtcggctgccccagctcctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccaggtgagccctcca
cggacagctgcctcacacacgtctctgctttctccccagctggctcgctacaccaaggag
ggcttcctgcacttgggcgccctggggaccaccacgctcctccctgacacccgctgcctg
gtggacaacgccaagagtcggctgccccagctcctggactgcgacaaggtcaagagcagc
ctgtacaagcgctggaacttcatccagaacggcgccatcatgaacagaggcacggggcgc
tgcctggaggtggagaaccgaggcgggcctgccatgctctggaccagccacaccgggaga
gaaacagcgagacaccggggggtgctcagtggggcttctccagggcagcccggggccccc
ggtggagactctgcgtcttcatcaggcatccagctttccgaggctcatgcaccctgggaa
aggcccctgacccttctctgggaacccagaagccgagtcttctgcagcccagatgtggat
ctggtaccaaggagcaacacatcacatctcctcttgggcatcttcccacccgccgtcagg
acgggactggcagaggcccctcctttttctcatctcccttcaacaaaggggagtgggctg
ggccacatcctcgctcctcctcctccaagaaggcagcaaggccctgggactcagtttccc
ccaggttgcctctgtccagatgcccatttacagcccaagatcaccaccccaaacctttcc
agccggtggccttggacttcgctggactctcacccctga

DBGET integrated database retrieval system