KEGG   Ovis aries (sheep): 101109669
Entry
101109669         CDS       T03117                                 

Gene name
ERCC4
Definition
(RefSeq) DNA repair endonuclease XPF
  KO
K10848  DNA excision repair protein ERCC-4 [EC:3.1.-.-]
Organism
oas  Ovis aries (sheep)
Pathway
oas03420  Nucleotide excision repair
oas03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    101109669 (ERCC4)
   03460 Fanconi anemia pathway
    101109669 (ERCC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:oas03032]
    101109669 (ERCC4)
   03400 DNA repair and recombination proteins [BR:oas03400]
    101109669 (ERCC4)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     101109669 (ERCC4)
DNA replication proteins [BR:oas03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     101109669 (ERCC4)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101109669 (ERCC4)
SSDB
Motif
Pfam: ERCC4 HHH_5
Other DBs
NCBI-GeneID: 101109669
NCBI-ProteinID: XP_027816917
LinkDB
Position
24
AA seq 914 aa
MEPAPARTTAMAPLLEYERQLVLELLDADGLVVCARGLGADRLLYHFLRLHCHPACLVLV
LNTQPAEEEYFINQLKIEGVEHLPRRVTNEITSSNRYEVYTQGGVIFATSRILVVDFLTD
RIPSDLITGILVYRAHRIIESCQEAFILRLFRQKNKRGFIKAFTDNAVAFDTGFCHVERV
MRNLFVRKLYLWPRFHVAVNSFLELHKPEVVEIHVSMTPAMLAIQTAILDILNACLKELK
CHNPSLEVEDLSLENAIGKPFDKTIRHYLDPLWHQLGAKTKSLVQDLKILRTLLQYLSQY
DCITFLNLLESLRATEKAFGQNSGWLFLDSSTSMFVNARARVYHVPDAKMTRKSKLPEKL
EIKEQETKKELVLESNPKWAALTEVLKEIEAENKESEVLGGPGQVLICASDDRTCSQLRE
YLTVGAEVFLLRLYRKTFEKDSKAEDVWMRLRKEDDSKRIMKSNKRPKDLQDKDRPPAKE
KALRKKKPRMTLTQMVGRAEALEGEAGAEEGSPGELTSSPESCTEDIKHEEFDVNVSSDA
AYGILKDPLTIIHPLLGCSDPYALTRVLHEVEPRYVVLYDAELTFVRQLEIYRATRPGKP
LRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVIPEEREGRDETNLDLVRGCVS
ARAPTDTRKAGGQEQNSTQQSIVVDMREFRSELPSLIHRRGIDIEPVTLEVGDYILTPEM
CVERKSISDLIGSLNNGRLYSQCISMSRYYKRPVLLIEFDPTKPFSLMSRGAFYQEISGN
DVSSKLTLLTLHFPRLRILWSPSPHATAELFEELKQNKPQPDATTAMAVTADSETLPEAE
KYNPGPQDFLLKMPGINAKNCHSLMNHVKNIAELASLSFDKLASMLGNTASARQLYDFIH
TSYAEVLSRGKMKK
NT seq 2745 nt   +upstreamnt  +downstreamnt
atggagccggcgccggctcgaacgactgctatggcgccgctcttggaatatgagcggcag
ctggtgttggaactgttggacgccgacggactggtagtgtgcgcccgcgggctcggcgcg
gaccggctcctctatcacttcctccggctgcactgccacccggcgtgcctagtgctggtg
ctcaacacgcagccggccgaggaggagtattttatcaatcagctgaagatagaaggagtt
gaacatctccctcgccgagtaacaaatgaaatcacaagtagcaatcgctatgaagtatat
acacaaggcggtgtgatatttgcaacaagcagaatacttgtagttgatttcctgactgat
agaataccttcagatttaattaccggcatcttggtatatagagctcacagaataatcgag
tcttgtcaagaagcattcatcttgcgcctctttcgacagaaaaacaaacgtggttttatt
aaagccttcacagacaacgctgttgcctttgacactggcttttgtcacgtggaaagagtg
atgagaaatctttttgtaaggaagctgtatctgtggccaaggttccatgtagcagtaaac
tcgtttttagaactgcataaacccgaagttgtagaaattcatgtttctatgacacctgcc
atgcttgctatacagactgctattctggacattttaaatgcctgtttaaaggaattaaaa
tgccataacccatcgcttgaagttgaagatttatctttagaaaatgctattggaaaacct
tttgacaagacgattcgccattacttagatcctttgtggcaccagcttggagccaagact
aaatccttggttcaggatttgaagatactacgaaccctgctgcagtatctctctcagtat
gattgtatcacatttcttaatcttctggaatctctcagagcaacagagaaggcattcggt
cagaattcaggttggctctttcttgactccagcacctcaatgtttgtaaatgctcgagca
agggtttatcatgttccagatgcaaaaatgactagaaaaagcaaacttcctgaaaaactg
gagattaaagaacaagaaacaaaaaaagaactggtcctagaaagcaacccaaagtgggca
gcactcacagaagttttgaaggaaattgaggcagagaataaggagagtgaagtccttggt
ggtccaggacaagttctcatttgcgcaagtgatgacaggacgtgttcccagctgcgagag
tacctcactgtcggagcagaggtcttcttgttgagactctatagaaaaacctttgagaag
gacagcaaagccgaagatgtatggatgaggttaaggaaggaagatgactcaaagagaatc
atgaaatccaacaagaggcccaaagacctccaagacaaagacaggcctcctgccaaagag
aaggccctgagaaagaagaaaccaaggatgactttaactcagatggtaggaagagctgaa
gcactagagggggaggcgggtgctgaggagggcagcccaggagagctgacgagtagccca
gagagctgcacagaagacattaagcacgaggagtttgatgtgaatgtgtcctccgatgca
gcctacggaatcctgaaagaccccctcaccatcatccacccgctcctgggctgcagtgat
ccctacgctctgacacgcgtgctccacgaggtggagccgagatacgtggtcttgtatgac
gcagagctgaccttcgtgcgtcagcttgaaatttacagggcgactcggcccgggaagcct
ctcagggtttactttcttatatacggaggttcaacggaggaacagcgctatctcactgct
ttgcggaaagaaaaggaagcttttgaaaagctcataagggaaaaggccagcatggtcatc
cctgaagaaagagaaggcagagacgaaacgaaccttgaccttgtgagaggctgcgtgtct
gcccgtgctcccaccgacacgcgcaaagccggcggccaagagcagaacagtacccagcag
agcatcgttgtggacatgcgggagtttcgaagtgagctcccctccctgatccaccgccgg
ggcatcgacattgagccagtgactctggaggtcggagactacatcctgactccggaaatg
tgcgtggagcgcaagagcatcagtgatctgattggctctttgaacaacggccgcctctac
agccagtgcatctccatgtcccgctactacaagcggccggtgcttctgatcgagttcgac
cccactaagcctttctctctcatgtcccgcggcgccttctatcaggagatctccggcaac
gatgtcagctccaagctcaccctcctcacgctgcacttcccccggctccggatcctctgg
agcccctccccgcacgccaccgccgagctgtttgaggagctgaagcagaacaagccgcag
ccagacgccaccaccgccatggctgtgaccgccgattccgagactctccccgaggcagag
aagtataacccaggtccccaggacttcttgttaaaaatgccagggataaacgccaagaac
tgccactcgttgatgaaccacgtcaagaacatcgcggaattagcaagcctgtccttcgac
aagctggcgagcatgctggggaacacggccagtgcgcggcagctctatgacttcattcac
acttcctatgcagaggtcctgtccagagggaagatgaaaaaatga

DBGET integrated database retrieval system