KEGG   Ovis aries (sheep): 101109759
Entry
101109759         CDS       T03117                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oas  Ovis aries (sheep)
Pathway
oas00562  Inositol phosphate metabolism
oas01100  Metabolic pathways
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04070  Phosphatidylinositol signaling system
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04670  Leukocyte transendothelial migration
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04930  Type II diabetes mellitus
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04960  Aldosterone-regulated sodium reabsorption
oas04973  Carbohydrate digestion and absorption
oas05010  Alzheimer disease
oas05017  Spinocerebellar ataxia
oas05020  Prion disease
oas05100  Bacterial invasion of epithelial cells
oas05132  Salmonella infection
oas05135  Yersinia infection
oas05142  Chagas disease
oas05146  Amoebiasis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101109759 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101109759 (PIK3CB)
   04014 Ras signaling pathway
    101109759 (PIK3CB)
   04015 Rap1 signaling pathway
    101109759 (PIK3CB)
   04370 VEGF signaling pathway
    101109759 (PIK3CB)
   04630 JAK-STAT signaling pathway
    101109759 (PIK3CB)
   04668 TNF signaling pathway
    101109759 (PIK3CB)
   04066 HIF-1 signaling pathway
    101109759 (PIK3CB)
   04068 FoxO signaling pathway
    101109759 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    101109759 (PIK3CB)
   04072 Phospholipase D signaling pathway
    101109759 (PIK3CB)
   04071 Sphingolipid signaling pathway
    101109759 (PIK3CB)
   04024 cAMP signaling pathway
    101109759 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    101109759 (PIK3CB)
   04152 AMPK signaling pathway
    101109759 (PIK3CB)
   04150 mTOR signaling pathway
    101109759 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101109759 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    101109759 (PIK3CB)
   04218 Cellular senescence
    101109759 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101109759 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    101109759 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101109759 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101109759 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    101109759 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    101109759 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    101109759 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    101109759 (PIK3CB)
   04660 T cell receptor signaling pathway
    101109759 (PIK3CB)
   04662 B cell receptor signaling pathway
    101109759 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    101109759 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    101109759 (PIK3CB)
   04670 Leukocyte transendothelial migration
    101109759 (PIK3CB)
   04062 Chemokine signaling pathway
    101109759 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101109759 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    101109759 (PIK3CB)
   04929 GnRH secretion
    101109759 (PIK3CB)
   04915 Estrogen signaling pathway
    101109759 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    101109759 (PIK3CB)
   04917 Prolactin signaling pathway
    101109759 (PIK3CB)
   04926 Relaxin signaling pathway
    101109759 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    101109759 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    101109759 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101109759 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101109759 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    101109759 (PIK3CB)
   04722 Neurotrophin signaling pathway
    101109759 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101109759 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    101109759 (PIK3CB)
   04380 Osteoclast differentiation
    101109759 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    101109759 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    101109759 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101109759 (PIK3CB)
   05206 MicroRNAs in cancer
    101109759 (PIK3CB)
   05205 Proteoglycans in cancer
    101109759 (PIK3CB)
   05203 Viral carcinogenesis
    101109759 (PIK3CB)
   05230 Central carbon metabolism in cancer
    101109759 (PIK3CB)
   05231 Choline metabolism in cancer
    101109759 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101109759 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101109759 (PIK3CB)
   05212 Pancreatic cancer
    101109759 (PIK3CB)
   05225 Hepatocellular carcinoma
    101109759 (PIK3CB)
   05226 Gastric cancer
    101109759 (PIK3CB)
   05214 Glioma
    101109759 (PIK3CB)
   05221 Acute myeloid leukemia
    101109759 (PIK3CB)
   05220 Chronic myeloid leukemia
    101109759 (PIK3CB)
   05218 Melanoma
    101109759 (PIK3CB)
   05211 Renal cell carcinoma
    101109759 (PIK3CB)
   05215 Prostate cancer
    101109759 (PIK3CB)
   05213 Endometrial cancer
    101109759 (PIK3CB)
   05224 Breast cancer
    101109759 (PIK3CB)
   05222 Small cell lung cancer
    101109759 (PIK3CB)
   05223 Non-small cell lung cancer
    101109759 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101109759 (PIK3CB)
   05017 Spinocerebellar ataxia
    101109759 (PIK3CB)
   05020 Prion disease
    101109759 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101109759 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101109759 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    101109759 (PIK3CB)
   04931 Insulin resistance
    101109759 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101109759 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101109759 (PIK3CB)
   05135 Yersinia infection
    101109759 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    101109759 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101109759 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    101109759 (PIK3CB)
   05161 Hepatitis B
    101109759 (PIK3CB)
   05160 Hepatitis C
    101109759 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    101109759 (PIK3CB)
   05164 Influenza A
    101109759 (PIK3CB)
   05162 Measles
    101109759 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    101109759 (PIK3CB)
   05163 Human cytomegalovirus infection
    101109759 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101109759 (PIK3CB)
   05169 Epstein-Barr virus infection
    101109759 (PIK3CB)
   05165 Human papillomavirus infection
    101109759 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101109759 (PIK3CB)
   05142 Chagas disease
    101109759 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101109759 (PIK3CB)
   01524 Platinum drug resistance
    101109759 (PIK3CB)
   01522 Endocrine resistance
    101109759 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101109759 (PIK3CB)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101109759 (PIK3CB)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101109759 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 101109759
NCBI-ProteinID: XP_004003351
Ensembl: ENSOARG00000007245
UniProt: A0A6P3E769
LinkDB
Position
1
AA seq 1070 aa
MCFYFIMPPAMADVLDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISCIKQMLW
KQVTNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGRGLHEFDALKDPEVNEFRIKMRRFSEEKIQSLVGLSWMDWLKHTYPPEL
EPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKINELAIQKRLTIHGKEDE
VSPYDYVLQVSGRVEYVFGDQSLIQFQYIRNCVMNRTLPHFILVECCKIKKLYEQEMVAI
EAAINRNSSNLPLPLPPKKTRIISHVWENNNPFQIVLVKGNKLNTEETVKVHVRAGLFHG
TELLCKTVVSSEISGKNDHVWNESLEFDINTCDLPRMTRLCFAVYAVLDKVKTKKSTKTM
NPSKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPHALPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLQQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKALSKQVEALNKLK
TLNSLIKLNAMKLNRAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttctacttcatcatgcctcctgctatggcagacgtccttgacatctgggcagtg
gactcacagatagcatctgatggctccatacccgtggattttcttttgcccactgggatt
tatatccagttggaggtgcctcgtgaagctaccatttcctgtattaagcagatgttatgg
aaacaagttaccaattacccaatgtttaacctccttatggaaatcgactcttatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagctcgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaagaggtctgcatgaatttgatgccttg
aaggatcctgaagtgaatgaattccgaataaaaatgcgcagatttagtgaggaaaagatt
cagtcgcttgtgggattatcttggatggattggctaaagcatacctatccacctgaactt
gaaccatccatccctgaaaatttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggatgtgtttagttttcaggtatctcctaatatgaatcct
atcaaaataaatgaattggcaatccaaaaacgtctaactattcatgggaaagaagatgaa
gttagcccttatgactatgtgttgcaagtcagtgggagagtagaatatgtgtttggtgat
cagtcactaattcagttccagtatatccggaactgtgtgatgaacagaacattgccccat
tttatacttgtggaatgttgcaagatcaagaagctgtatgaacaggaaatggttgccata
gaggctgccataaatcgaaattcatctaacctccctcttcctttaccaccaaagaaaact
cgaattatttctcatgtctgggaaaataacaatcctttccaaattgtcttggttaaagga
aataaacttaacacagaagaaactgtaaaagttcatgtcagggccggcctttttcatggt
accgaactcctgtgtaaaactgttgtaagctcagagatatcagggaagaatgatcatgtt
tggaatgaatcactggaatttgatatcaatacttgtgacctgccacgaatgactcgatta
tgttttgctgtttatgcagttttggataaagtgaaaactaagaaatcaactaaaaccatg
aatccctctaagtatcagaccatcaggaaatctggaaaagtgcattatcctgtagcctgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagatataatattacac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatacagaaaatgcaacagctttgcacataaaattcccagagaataaaaaa
caaccttattactatcctcccttcgataagattattgaaaaagcagctgagattgcaagc
agtgatagtgctaatgtatcaagtcgaggtggaaagaagtttcttgctgtactaaaagaa
atcttggacagggatccattgtctcaactgtgtgagaatgaaatggatcttatttggact
ttgcgacaagactgcagagagaatttcccacacgcattgccaaaattgctgctgtcgatc
aagtggaataaacttgaggatgttgctcagcttcaagcactgcttcagatttggcctaaa
ctgcccccccgggaggcccttgagcttctagatttcaattatccagatcagtatgtgcga
gaatatgctgtgggctgcctacaacagatgagtgatgaagaactctctcaatatctttta
cagttggtgcaagttttaaaatatgagccttttctcgattgtgccttgtctagattccta
ctagaaagagcacttgctaatcggaggatagggcagtttttattttggcaccttagatct
gaagtacacattcctgctgtttcagtacaatttggtgttatccttgaagcgtactgccgg
ggaagcgtaggtcacatgaaagcgctttctaagcaggttgaagcactcaataaactaaaa
actttaaatagtttaatcaaactgaatgcaatgaagcttaatagagccaaagggaaagaa
gcaatgcatacttgtctaaaacagaatgcttaccgtgaagccctctctgacctgcagtca
cctctgaacccatgtgttatcctctcagaactctatgttgagaagtgtaaatacatggat
tccaaaatgaagcctttgtggcttgtgtacaacaacaaggtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacggcaggatatgttgacactccaaatgctg
cgcttgatggatttactttggaaagaagctggtctggaccttcggatgctaccttatggc
tgcttagcaacaggagaccgttctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgttgctgcagcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctggaccgagccattgaggag
tttaccctatcctgtgccggctactgtgtagcttcttatgtccttgggattggtgacaga
catagtgataacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggagcgagtgccttttattctt
acttatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaaatttggc
cggttccgccagtgttgtgaggatgcatatctgattttacgccggcatgggaatctcttc
atcacgctgtttgcactgatgttgactgcagggcttcctgagctcacttcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
ttcaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtcaattggatg
gcccacacagttcggaaagactacagatcttaa

KEGG   Ovis aries (sheep): 101110015
Entry
101110015         CDS       T03117                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oas  Ovis aries (sheep)
Pathway
oas00562  Inositol phosphate metabolism
oas01100  Metabolic pathways
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04070  Phosphatidylinositol signaling system
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04670  Leukocyte transendothelial migration
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04930  Type II diabetes mellitus
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04960  Aldosterone-regulated sodium reabsorption
oas04973  Carbohydrate digestion and absorption
oas05010  Alzheimer disease
oas05017  Spinocerebellar ataxia
oas05020  Prion disease
oas05100  Bacterial invasion of epithelial cells
oas05132  Salmonella infection
oas05135  Yersinia infection
oas05142  Chagas disease
oas05146  Amoebiasis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101110015 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101110015 (PIK3CA)
   04014 Ras signaling pathway
    101110015 (PIK3CA)
   04015 Rap1 signaling pathway
    101110015 (PIK3CA)
   04370 VEGF signaling pathway
    101110015 (PIK3CA)
   04630 JAK-STAT signaling pathway
    101110015 (PIK3CA)
   04668 TNF signaling pathway
    101110015 (PIK3CA)
   04066 HIF-1 signaling pathway
    101110015 (PIK3CA)
   04068 FoxO signaling pathway
    101110015 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    101110015 (PIK3CA)
   04072 Phospholipase D signaling pathway
    101110015 (PIK3CA)
   04071 Sphingolipid signaling pathway
    101110015 (PIK3CA)
   04024 cAMP signaling pathway
    101110015 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    101110015 (PIK3CA)
   04152 AMPK signaling pathway
    101110015 (PIK3CA)
   04150 mTOR signaling pathway
    101110015 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101110015 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    101110015 (PIK3CA)
   04218 Cellular senescence
    101110015 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101110015 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    101110015 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101110015 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101110015 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    101110015 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    101110015 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    101110015 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    101110015 (PIK3CA)
   04660 T cell receptor signaling pathway
    101110015 (PIK3CA)
   04662 B cell receptor signaling pathway
    101110015 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    101110015 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    101110015 (PIK3CA)
   04670 Leukocyte transendothelial migration
    101110015 (PIK3CA)
   04062 Chemokine signaling pathway
    101110015 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101110015 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    101110015 (PIK3CA)
   04929 GnRH secretion
    101110015 (PIK3CA)
   04915 Estrogen signaling pathway
    101110015 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    101110015 (PIK3CA)
   04917 Prolactin signaling pathway
    101110015 (PIK3CA)
   04926 Relaxin signaling pathway
    101110015 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    101110015 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    101110015 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101110015 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101110015 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    101110015 (PIK3CA)
   04722 Neurotrophin signaling pathway
    101110015 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101110015 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    101110015 (PIK3CA)
   04380 Osteoclast differentiation
    101110015 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    101110015 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    101110015 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101110015 (PIK3CA)
   05206 MicroRNAs in cancer
    101110015 (PIK3CA)
   05205 Proteoglycans in cancer
    101110015 (PIK3CA)
   05203 Viral carcinogenesis
    101110015 (PIK3CA)
   05230 Central carbon metabolism in cancer
    101110015 (PIK3CA)
   05231 Choline metabolism in cancer
    101110015 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101110015 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101110015 (PIK3CA)
   05212 Pancreatic cancer
    101110015 (PIK3CA)
   05225 Hepatocellular carcinoma
    101110015 (PIK3CA)
   05226 Gastric cancer
    101110015 (PIK3CA)
   05214 Glioma
    101110015 (PIK3CA)
   05221 Acute myeloid leukemia
    101110015 (PIK3CA)
   05220 Chronic myeloid leukemia
    101110015 (PIK3CA)
   05218 Melanoma
    101110015 (PIK3CA)
   05211 Renal cell carcinoma
    101110015 (PIK3CA)
   05215 Prostate cancer
    101110015 (PIK3CA)
   05213 Endometrial cancer
    101110015 (PIK3CA)
   05224 Breast cancer
    101110015 (PIK3CA)
   05222 Small cell lung cancer
    101110015 (PIK3CA)
   05223 Non-small cell lung cancer
    101110015 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101110015 (PIK3CA)
   05017 Spinocerebellar ataxia
    101110015 (PIK3CA)
   05020 Prion disease
    101110015 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101110015 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101110015 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    101110015 (PIK3CA)
   04931 Insulin resistance
    101110015 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101110015 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101110015 (PIK3CA)
   05135 Yersinia infection
    101110015 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    101110015 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101110015 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    101110015 (PIK3CA)
   05161 Hepatitis B
    101110015 (PIK3CA)
   05160 Hepatitis C
    101110015 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    101110015 (PIK3CA)
   05164 Influenza A
    101110015 (PIK3CA)
   05162 Measles
    101110015 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    101110015 (PIK3CA)
   05163 Human cytomegalovirus infection
    101110015 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101110015 (PIK3CA)
   05169 Epstein-Barr virus infection
    101110015 (PIK3CA)
   05165 Human papillomavirus infection
    101110015 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101110015 (PIK3CA)
   05142 Chagas disease
    101110015 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101110015 (PIK3CA)
   01524 Platinum drug resistance
    101110015 (PIK3CA)
   01522 Endocrine resistance
    101110015 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101110015 (PIK3CA)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101110015 (PIK3CA)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101110015 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 101110015
NCBI-ProteinID: XP_004003184
Ensembl: ENSOARG00000020711
UniProt: A0A6P3E0C7
LinkDB
Position
1
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRHYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatgggatgatagtgactttagaatgcctccgtgaggct
acattaataactataaagcatgaactatttaaagaagcaagaaaataccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgaaccagtaggcaaccgtgaagaaaagatcctcaatcgagaaattggttttgct
atcggcatgccagtatgtgaattcgatatggttaaagatccagaagtacaggacttccga
agaaatattctcaatgtttgtaaagaagctgtggatcttagggatcttaattcacctcat
agtagagcaatgtatgtttatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattggataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaaacagaagtatactctgaaaatcaaccatgactgtgtgccagaacaagta
attgctgaagcaatcaggaaaaaaactcgaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtgtgtggatgtgatgaatac
ttcctagaaaaatatcctctgagtcagtataagtatataagaagctgtataatgcttggg
aggatgcccaatttgatgctgatggctaaagaaagcctctactctcaactgccaatggac
tgttttacaatgccatcgtattccagacgcatctccacagctacgccatatatgaatgga
gaaacatctacaaaatccctttgggttataaatagtgcactcagaataaaaattctttgt
gcaacctatgtgaatgtaaatattcgagacattgacaagatttatgttcgaacaggtatc
taccatggaggagaacccttatgtgataatgtgaacactcaaagagtaccttgttccaat
cccaggtggaatgaatggctgaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctttgaatctttggccagtacctcatggactagaagatttgctgaaccctattggt
gttactggatcaaatccaaataaagaaactccatgtttagagttggagtttgactggttc
agcagtgtggtaaagtttccagatatgtcagtgattgaagagcatgccaactggtccgta
tcccgtgaagcaggatttagttattcccatgcaggactgagtaacagactagctagagac
aatgaattaagagaaaatgataaagaacagctccgagcaatttgtacacgagatcctcta
tctgaaatcactgagcaagagaaagattttctgtggagccacagacactattgtgtaact
atccccgaaattctacccaaattgcttctgtctgttaaatggaactctagagatgaagta
gctcagatgtactgcttggtaaaagattggcctccaatcaagcctgaacaggctatggag
cttctggactgcaattacccagatcctatggttcgaggttttgctgttcggtgcttagaa
aaatatttaacagatgacaaactttctcagtacctaattcagctagtacaggtactaaag
tatgaacagtatttggataacctgcttgtgagatttttactcaaaaaagcattaactaat
caaaggatcggtcactttttcttttggcatttaaaatctgagatgcacaataaaacagtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcatgtgggatgtatctgaag
caccttaataggcaagttgaggctatggaaaagctcattaacttgactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgcgg
cgaccagatttcatggatgctctccagggctttctgtctcctctaaaccctgctcatcag
ctgggaaatctcaggcttgaagagtgtcgaattatgtcttctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagaattactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacggcaagatatgctaacccttcagattattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggatgtctgtca
attggtgattgtgtgggacttattgaggtggtgagaaattctcacactataatgcagatt
cagtgtaaaggaggcctgaaaggtgcactgcagttcaacagccacacactccatcagtgg
ctcaaagacaagaacaagggagaaatatacgatgcagccatcgatttgtttacacggtcg
tgtgctggatattgtgttgcaaccttcatcttgggaattggagatcgtcacaatagtaat
atcatggttaaagatgatggacaactgtttcatatagattttggacattttttggatcac
aagaagaaaaaatttggttataaacgagagcgcgtgccgtttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaagaatgcacaaagacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgagcaagaggctttggaatatttcatg
aaacaaatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
acaattaagcagcatgctttgaactga

KEGG   Ovis aries (sheep): 101111546
Entry
101111546         CDS       T03117                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04070  Phosphatidylinositol signaling system
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04670  Leukocyte transendothelial migration
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04930  Type II diabetes mellitus
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04960  Aldosterone-regulated sodium reabsorption
oas04973  Carbohydrate digestion and absorption
oas05010  Alzheimer disease
oas05017  Spinocerebellar ataxia
oas05020  Prion disease
oas05100  Bacterial invasion of epithelial cells
oas05135  Yersinia infection
oas05142  Chagas disease
oas05146  Amoebiasis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101111546 (PIK3R2)
   04014 Ras signaling pathway
    101111546 (PIK3R2)
   04015 Rap1 signaling pathway
    101111546 (PIK3R2)
   04370 VEGF signaling pathway
    101111546 (PIK3R2)
   04630 JAK-STAT signaling pathway
    101111546 (PIK3R2)
   04668 TNF signaling pathway
    101111546 (PIK3R2)
   04066 HIF-1 signaling pathway
    101111546 (PIK3R2)
   04068 FoxO signaling pathway
    101111546 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    101111546 (PIK3R2)
   04072 Phospholipase D signaling pathway
    101111546 (PIK3R2)
   04071 Sphingolipid signaling pathway
    101111546 (PIK3R2)
   04024 cAMP signaling pathway
    101111546 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    101111546 (PIK3R2)
   04152 AMPK signaling pathway
    101111546 (PIK3R2)
   04150 mTOR signaling pathway
    101111546 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101111546 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    101111546 (PIK3R2)
   04218 Cellular senescence
    101111546 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101111546 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101111546 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101111546 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101111546 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    101111546 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    101111546 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    101111546 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    101111546 (PIK3R2)
   04660 T cell receptor signaling pathway
    101111546 (PIK3R2)
   04662 B cell receptor signaling pathway
    101111546 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    101111546 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    101111546 (PIK3R2)
   04670 Leukocyte transendothelial migration
    101111546 (PIK3R2)
   04062 Chemokine signaling pathway
    101111546 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101111546 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    101111546 (PIK3R2)
   04929 GnRH secretion
    101111546 (PIK3R2)
   04915 Estrogen signaling pathway
    101111546 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    101111546 (PIK3R2)
   04917 Prolactin signaling pathway
    101111546 (PIK3R2)
   04926 Relaxin signaling pathway
    101111546 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    101111546 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    101111546 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101111546 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101111546 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    101111546 (PIK3R2)
   04722 Neurotrophin signaling pathway
    101111546 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101111546 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    101111546 (PIK3R2)
   04380 Osteoclast differentiation
    101111546 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    101111546 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    101111546 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101111546 (PIK3R2)
   05206 MicroRNAs in cancer
    101111546 (PIK3R2)
   05205 Proteoglycans in cancer
    101111546 (PIK3R2)
   05203 Viral carcinogenesis
    101111546 (PIK3R2)
   05230 Central carbon metabolism in cancer
    101111546 (PIK3R2)
   05231 Choline metabolism in cancer
    101111546 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101111546 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101111546 (PIK3R2)
   05212 Pancreatic cancer
    101111546 (PIK3R2)
   05225 Hepatocellular carcinoma
    101111546 (PIK3R2)
   05226 Gastric cancer
    101111546 (PIK3R2)
   05214 Glioma
    101111546 (PIK3R2)
   05221 Acute myeloid leukemia
    101111546 (PIK3R2)
   05220 Chronic myeloid leukemia
    101111546 (PIK3R2)
   05218 Melanoma
    101111546 (PIK3R2)
   05211 Renal cell carcinoma
    101111546 (PIK3R2)
   05215 Prostate cancer
    101111546 (PIK3R2)
   05213 Endometrial cancer
    101111546 (PIK3R2)
   05224 Breast cancer
    101111546 (PIK3R2)
   05222 Small cell lung cancer
    101111546 (PIK3R2)
   05223 Non-small cell lung cancer
    101111546 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101111546 (PIK3R2)
   05017 Spinocerebellar ataxia
    101111546 (PIK3R2)
   05020 Prion disease
    101111546 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101111546 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101111546 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    101111546 (PIK3R2)
   04931 Insulin resistance
    101111546 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101111546 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101111546 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    101111546 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101111546 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    101111546 (PIK3R2)
   05161 Hepatitis B
    101111546 (PIK3R2)
   05160 Hepatitis C
    101111546 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    101111546 (PIK3R2)
   05164 Influenza A
    101111546 (PIK3R2)
   05162 Measles
    101111546 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    101111546 (PIK3R2)
   05163 Human cytomegalovirus infection
    101111546 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101111546 (PIK3R2)
   05169 Epstein-Barr virus infection
    101111546 (PIK3R2)
   05165 Human papillomavirus infection
    101111546 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101111546 (PIK3R2)
   05142 Chagas disease
    101111546 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101111546 (PIK3R2)
   01524 Platinum drug resistance
    101111546 (PIK3R2)
   01522 Endocrine resistance
    101111546 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101111546 (PIK3R2)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101111546 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Laminin_I Tai4
Other DBs
NCBI-GeneID: 101111546
NCBI-ProteinID: XP_027825218
UniProt: A0A6P7E2B7
LinkDB
Position
5
AA seq 811 aa
MAGPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPAGPFCSSSTTWPI
TQGGPTGPGLPLLCARASPPRAKAASNGGCADRERLNTKGLTLPDLPEQFSPPDVAPPIL
VKLVEAIERTGLDSYRPEPPTMRTGEGELQWASGKGTCPGQMCPVPVPALDRGIPLAPAD
WSLGDVEQWDAAALSEGVKSFLLALPAPLVTPEAAAEAHRALREAAGPVGPALEPPTLPL
HHALTLRFLLQHLGRVAGRAPAPGPAVRALGATFGPLLLRAPPPPSPPPGGAPDGTEPTP
DFPALLVEKLLQEHLEEQEVAPPALPPKPPKTKPAPTGLANGGSPPSLQDAEWYWGDISR
EEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCS
VVDLITHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVGAQLKVYHQQYQDKS
REYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSKEYLERFRREGNEKE
MQRILLNSERLKSRIAEIHESRTKLEQELRAQASDNREIDKRMNSLKPDLMQLRKIRDQY
LVWLTQKGARQKKINEWLGIKNETEDQYSLMEDEDDLPHHEERTWYVGKINRTQAEEMLS
GKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELVLHYQ
HASLVQHNDALTVTLAHPVRAPGPGPPPAAR
NT seq 2436 nt   +upstreamnt  +downstreamnt
atggctggccctgagggcttccaataccgtgcattgtacccattccgccgggagcggccg
gaggacctggagctacttccgggtgatgtgctggtggtgagcagggccgccctgcaggcg
ctgggcgtggccgagggcaacgagcgctgcccgcagagcgtcggctggatgcctggcctc
aatgagcgtacccggcaacgcggtgacttccctggcacctatgtggagttcctggggccc
gtggccctggcccggcctggccctcgcccacgtggcccccgcccactgcccgccaggccc
cgagacgggccccctgagccagctgggcctttctgcagctcaagcaccacctggcccatc
actcagggaggccccacaggccctggcttgcccctgctgtgtgccagggcgtccccgcca
agggccaaagctgcatcaaatggtggctgtgccgacagagagcgcctgaacacaaaaggc
ctgacactccctgacctacccgagcagttctcaccccctgatgtggctccccctatcctg
gtgaagctggtggaggccattgaacggacagggctggacagctacaggcctgagccaccc
accatgcgcacaggtgagggcgagcttcagtgggcgagtgggaaaggaacctgccctgga
cagatgtgtcctgtccctgtgcccgccttggaccgaggtatcccccttgcacccgcagac
tggtccctgggtgatgtggagcagtgggatgcggcagccctgtcagagggtgtgaaaagc
ttcctgctggcgctgccggcgcccctcgtgacacccgaggccgcggccgaggcacaccga
gccctgcgggaggctgcggggcccgtggggccggcgctggagcccccgacgctgccactg
caccatgcgctcacgctgcgcttcctgctccagcacctgggccgggtggccgggcgcgcc
ccagccccgggccccgcggtccgtgccctgggcgccaccttcgggccgctgctgctgcgc
gcgccgccgccgccctctccgccgccagggggcgcgcccgacgggaccgagcccaccccc
gactttcctgcgctgctggtggagaagctgcttcaggaacacctggaggagcaggaggtt
gcccccccagcactgccaccaaaaccccccaagacaaagccagcccccacaggcctggcc
aatgggggcagcccaccctccctgcaggacgccgagtggtactggggtgacatctccagg
gaggaggtaaacgagaaactgcgggacacgcccgatggcaccttcctggtccgagatgcc
tccagcaagatccagggagagtacacgctgaccctcaggaagggcggaaacaacaagctg
atcaaggtcttccaccgagacgggcactacggcttctcggagccgctcaccttctgctct
gtcgtggacctcatcacccactaccgccacgagtcactggcccagtacaacgccaagctg
gacacgcggctcctctatccggtgtccaagtaccaacaggaccagatcgtcaaggaggac
agcgtggaggcggtgggtgcccagctcaaggtctaccaccagcagtaccaggacaagagc
cgcgagtacgaccaactctacgaggagtacacgcgcacctcccaggaactgcagatgaag
cgcacagccatcgaagccttcaatgagaccatcaagatcttcgaagagcagggccagacg
caggagaagtgcagcaaggagtatctggagcgcttccggcgtgagggcaacgagaaagaa
atgcagaggatcctgctcaactcggagcggctcaagtctcgcattgctgagatccatgag
agccgcacaaagctggagcaggagctgcgggcacaggcctctgacaaccgagagatcgac
aagcgcatgaacagcctcaagccagacctcatgcagttgcgcaagatccgagaccagtac
cttgtgtggctcactcagaaaggtgcccggcagaagaaaatcaacgaatggttggggatc
aagaacgagactgaggaccagtactcactgatggaggatgaggatgacctcccccaccac
gaggaacgcacatggtatgtaggcaagatcaaccgcacccaagctgaggaaatgctgagt
ggcaagcgggacggtaccttcctcatccgtgagagcagccagcggggttgctacgcctgt
tccgtggtggtggacggcgataccaagcactgcgtcatctaccgcacggccacgggcttc
ggcttcgcggagccctacaacctgtacgggtccctgaaggagctcgtcctccactaccag
cacgcctccctggtgcagcacaatgacgcgctgaccgtcacgctcgctcaccccgtgcgc
gcccccgggcccgggcccccgcccgctgcacgctga

KEGG   Ovis aries (sheep): 101117348
Entry
101117348         CDS       T03117                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
oas  Ovis aries (sheep)
Pathway
oas00562  Inositol phosphate metabolism
oas01100  Metabolic pathways
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04070  Phosphatidylinositol signaling system
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04670  Leukocyte transendothelial migration
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04930  Type II diabetes mellitus
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04960  Aldosterone-regulated sodium reabsorption
oas04973  Carbohydrate digestion and absorption
oas05010  Alzheimer disease
oas05017  Spinocerebellar ataxia
oas05020  Prion disease
oas05100  Bacterial invasion of epithelial cells
oas05132  Salmonella infection
oas05135  Yersinia infection
oas05142  Chagas disease
oas05146  Amoebiasis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101117348 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101117348 (PIK3CD)
   04014 Ras signaling pathway
    101117348 (PIK3CD)
   04015 Rap1 signaling pathway
    101117348 (PIK3CD)
   04370 VEGF signaling pathway
    101117348 (PIK3CD)
   04630 JAK-STAT signaling pathway
    101117348 (PIK3CD)
   04668 TNF signaling pathway
    101117348 (PIK3CD)
   04066 HIF-1 signaling pathway
    101117348 (PIK3CD)
   04068 FoxO signaling pathway
    101117348 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    101117348 (PIK3CD)
   04072 Phospholipase D signaling pathway
    101117348 (PIK3CD)
   04071 Sphingolipid signaling pathway
    101117348 (PIK3CD)
   04024 cAMP signaling pathway
    101117348 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    101117348 (PIK3CD)
   04152 AMPK signaling pathway
    101117348 (PIK3CD)
   04150 mTOR signaling pathway
    101117348 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101117348 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    101117348 (PIK3CD)
   04218 Cellular senescence
    101117348 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101117348 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    101117348 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101117348 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101117348 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    101117348 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    101117348 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    101117348 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    101117348 (PIK3CD)
   04660 T cell receptor signaling pathway
    101117348 (PIK3CD)
   04662 B cell receptor signaling pathway
    101117348 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    101117348 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    101117348 (PIK3CD)
   04670 Leukocyte transendothelial migration
    101117348 (PIK3CD)
   04062 Chemokine signaling pathway
    101117348 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101117348 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    101117348 (PIK3CD)
   04929 GnRH secretion
    101117348 (PIK3CD)
   04915 Estrogen signaling pathway
    101117348 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    101117348 (PIK3CD)
   04917 Prolactin signaling pathway
    101117348 (PIK3CD)
   04926 Relaxin signaling pathway
    101117348 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    101117348 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    101117348 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101117348 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101117348 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    101117348 (PIK3CD)
   04722 Neurotrophin signaling pathway
    101117348 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101117348 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    101117348 (PIK3CD)
   04380 Osteoclast differentiation
    101117348 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    101117348 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    101117348 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101117348 (PIK3CD)
   05206 MicroRNAs in cancer
    101117348 (PIK3CD)
   05205 Proteoglycans in cancer
    101117348 (PIK3CD)
   05203 Viral carcinogenesis
    101117348 (PIK3CD)
   05230 Central carbon metabolism in cancer
    101117348 (PIK3CD)
   05231 Choline metabolism in cancer
    101117348 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101117348 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101117348 (PIK3CD)
   05212 Pancreatic cancer
    101117348 (PIK3CD)
   05225 Hepatocellular carcinoma
    101117348 (PIK3CD)
   05226 Gastric cancer
    101117348 (PIK3CD)
   05214 Glioma
    101117348 (PIK3CD)
   05221 Acute myeloid leukemia
    101117348 (PIK3CD)
   05220 Chronic myeloid leukemia
    101117348 (PIK3CD)
   05218 Melanoma
    101117348 (PIK3CD)
   05211 Renal cell carcinoma
    101117348 (PIK3CD)
   05215 Prostate cancer
    101117348 (PIK3CD)
   05213 Endometrial cancer
    101117348 (PIK3CD)
   05224 Breast cancer
    101117348 (PIK3CD)
   05222 Small cell lung cancer
    101117348 (PIK3CD)
   05223 Non-small cell lung cancer
    101117348 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101117348 (PIK3CD)
   05017 Spinocerebellar ataxia
    101117348 (PIK3CD)
   05020 Prion disease
    101117348 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101117348 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101117348 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    101117348 (PIK3CD)
   04931 Insulin resistance
    101117348 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101117348 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101117348 (PIK3CD)
   05135 Yersinia infection
    101117348 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    101117348 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101117348 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    101117348 (PIK3CD)
   05161 Hepatitis B
    101117348 (PIK3CD)
   05160 Hepatitis C
    101117348 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    101117348 (PIK3CD)
   05164 Influenza A
    101117348 (PIK3CD)
   05162 Measles
    101117348 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    101117348 (PIK3CD)
   05163 Human cytomegalovirus infection
    101117348 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101117348 (PIK3CD)
   05169 Epstein-Barr virus infection
    101117348 (PIK3CD)
   05165 Human papillomavirus infection
    101117348 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101117348 (PIK3CD)
   05142 Chagas disease
    101117348 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101117348 (PIK3CD)
   01524 Platinum drug resistance
    101117348 (PIK3CD)
   01522 Endocrine resistance
    101117348 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101117348 (PIK3CD)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101117348 (PIK3CD)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101117348 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 101117348
NCBI-ProteinID: XP_027831458
Ensembl: ENSOARG00000007664
UniProt: A0A6P7EK04
LinkDB
Position
12
AA seq 1044 aa
MPPGVDCPMEFWTKEENQNVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLINSQISLL
IGKGLHEFDSLQDPEVNDFRGKMRQFCEEAAARRQQLGWEAWLQYSFPLQLEPSARSWGP
GTLRIPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSVSLWSLEQPFYIELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINICDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGERCLYMWPSVPDEKGELLNPCGTVRSNPNTESAAALVIFLPEVAP
HPVYYPSLDKILELGRLGEHGRFTEEEQLQLREILERRGSGELYEHEKDLVWKMRHEIQE
HFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRRIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVCSQKTPKPQAKELMHLCMR
QETYLEALSHLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGTVGIIFKN
GDDLRQDMLTLQMIQLMDILWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ETAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccccggggttgactgccccatggaattctggaccaaggaggagaatcagaatgtg
gcagttgatttcttgctgcccacgggggtctatctgaacttccctgtgtcccgaaatgcc
aacctcagcactatcaagaaggtgttatggcaccgcgcccagtatgagccgctcttccac
atgctcagtgaccctgaggcctacgtgttcacctgcgtcaaccagacggcggagcagcag
gagctggaggacgagcagcggcggctctgcgacatccagcccttcctgcctgtcctgcgg
ctggtggcccgcgaaggtgaccgcgtgaagaagctcatcaactcgcagatcagcctgctc
atcggcaaaggcctccacgagtttgactccttgcaagacccggaggtgaatgacttccga
ggcaagatgcgccagttctgcgaggaggcggctgcccgcaggcagcagctgggctgggag
gcctggctgcagtacagcttccctctgcagttggagccctcagcgcggagctgggggccg
ggcaccctgcgcatccccaatcgggccctcctggtcaatgtcaagtttgagggcagcgag
gagagcttcaccttccaggtatccaccaaggatgtgcccctggcactgatggcctgcgcc
ctccgaaagaaggccacggtgttccggcagccgctggtggagcagcctgaggactacaca
ctgcaggtgaacggcaagcatgagtacctgtacggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagtgggctgaccccccacctgaccatggtgcactcctcc
tccatcctcgccatgcgggacgagcagagcaaccctgccccccaagtccagaagccacgc
accaaaccgccccccatccccatgaagaagccctcctccgtgtccctctggtccctggag
cagcctttctacatcgagctgatccagggcagcaaagtgaatgccgacgagcggatgaag
ctggtggtgcaggccgggctcttccatggcaatgagacactatgcaagacagtgtccagc
tcagaggtgagcgtatgttcggagcccgtgtggaagcagcggctggagtttgacatcaac
atctgtgacctgccccgcatggcccggctctgcttcgcgctttacgccgtgatcgagaag
gccaagaaggcccgctccaccaagaagaagtccaagaaggcggactgccccattgcctgg
gccaacctcatgctgtttgactacaaggaccagctcaagacaggcgagcgctgtctctac
atgtggccctctgtcccagacgagaaaggggagctactgaacccctgtgggaccgtgagg
agtaaccccaacactgagagtgcagccgccctggtcatctttctccccgaggtggcccct
caccctgtatactacccttccctggacaagatcctggagctggggcggcttggagagcac
ggacgcttcacggaggaggagcagctgcagctgcgggagatcctggagcggcggggttcc
ggggaactgtacgagcacgagaaggacctggtgtggaagatgcggcacgagatccaggag
cactttcccgaggctctagcccggctgctgctggtcactaagtggaacaaacacgaggac
gtggcccagatgctctacctgctctgctcctggcctgaactgccggttctgagcgccctg
gagttgctagacttcagcttccccgaccgccacgtgggctccttcgccatcaagtccctg
cggaaactaacggacgacgagcttttccagtacctgctgcagctggtgcaggtgctcaag
tacgagtcctacctcgactgcgagctgaccaaatttctgctggaccgggccctggccaat
cgcaggatcggccacttcctcttctggcacctccgctccgagatgcacgtgccgtcggtg
gctctgcgattcggcctcatcatggaagcctattgccggggcagcacccaccacatgaag
gtgctgatgaagcagggggaagcactgagcaaactgaaggccctcaatgacttcgtcaaa
gtgtgctcccagaagacccccaaaccccaggccaaggagctgatgcacctgtgcatgcgc
caggagacctacctggaggccctctcccacttgcagtccccactcgaccccagcaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactccaagatgaaacccctgtgg
gtcatgtacagcaacgaggaggcaggcagcgatggcaccgtgggcatcatctttaagaat
ggggacgacctccgccaggacatgctgaccctgcagatgatccagctcatggacattctg
tggaagcaggagggcttggacctgaggatgaccccctacggctgcctctccactggggac
cgcacaggccttattgaggtggtgcttcactcggacaccattgccaacatccagctgaac
aagagcaacatggcggccacggccgccttcaataaggatgctctgctcaactggctcaag
tccaagaacccgggggaggccctggatcgagccattgaggagttcaccctctcctgtgct
ggctactgtgtggccacctatgtgctgggcatcggcgatcgccacagcgacaacatcatg
atccgagagaacgggcagctgttccacattgatttcggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgggtcccgttcatcctcacctatgactttgtccac
gtgatccagcaggggaagacgaataatagtgagaagtttgaaaggttccggggctattgt
gagacggcctacaccatcctgcggcgccatgggctccttttcctccacctctttgccctg
atgcgggcggcaggcctgcctgagctcagctgctccaaagacatccagtatctcaaggat
tctctggcattggggaaaacggaggaggaggctctgaagcacttccgagtgaagtttaat
gaagccctccgggaaagctggaaaaccaaagtgaactggctggcccacaacgtgtccaaa
gataacaggcaataa

KEGG   Ovis aries (sheep): 101121455
Entry
101121455         CDS       T03117                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X2
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04070  Phosphatidylinositol signaling system
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04670  Leukocyte transendothelial migration
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04930  Type II diabetes mellitus
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04960  Aldosterone-regulated sodium reabsorption
oas04973  Carbohydrate digestion and absorption
oas05010  Alzheimer disease
oas05017  Spinocerebellar ataxia
oas05020  Prion disease
oas05100  Bacterial invasion of epithelial cells
oas05135  Yersinia infection
oas05142  Chagas disease
oas05146  Amoebiasis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101121455 (PIK3R1)
   04014 Ras signaling pathway
    101121455 (PIK3R1)
   04015 Rap1 signaling pathway
    101121455 (PIK3R1)
   04370 VEGF signaling pathway
    101121455 (PIK3R1)
   04630 JAK-STAT signaling pathway
    101121455 (PIK3R1)
   04668 TNF signaling pathway
    101121455 (PIK3R1)
   04066 HIF-1 signaling pathway
    101121455 (PIK3R1)
   04068 FoxO signaling pathway
    101121455 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    101121455 (PIK3R1)
   04072 Phospholipase D signaling pathway
    101121455 (PIK3R1)
   04071 Sphingolipid signaling pathway
    101121455 (PIK3R1)
   04024 cAMP signaling pathway
    101121455 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    101121455 (PIK3R1)
   04152 AMPK signaling pathway
    101121455 (PIK3R1)
   04150 mTOR signaling pathway
    101121455 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101121455 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    101121455 (PIK3R1)
   04218 Cellular senescence
    101121455 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101121455 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101121455 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101121455 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101121455 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    101121455 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    101121455 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    101121455 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    101121455 (PIK3R1)
   04660 T cell receptor signaling pathway
    101121455 (PIK3R1)
   04662 B cell receptor signaling pathway
    101121455 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    101121455 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    101121455 (PIK3R1)
   04670 Leukocyte transendothelial migration
    101121455 (PIK3R1)
   04062 Chemokine signaling pathway
    101121455 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101121455 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    101121455 (PIK3R1)
   04929 GnRH secretion
    101121455 (PIK3R1)
   04915 Estrogen signaling pathway
    101121455 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    101121455 (PIK3R1)
   04917 Prolactin signaling pathway
    101121455 (PIK3R1)
   04926 Relaxin signaling pathway
    101121455 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    101121455 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    101121455 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101121455 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101121455 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    101121455 (PIK3R1)
   04722 Neurotrophin signaling pathway
    101121455 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101121455 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    101121455 (PIK3R1)
   04380 Osteoclast differentiation
    101121455 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    101121455 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    101121455 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101121455 (PIK3R1)
   05206 MicroRNAs in cancer
    101121455 (PIK3R1)
   05205 Proteoglycans in cancer
    101121455 (PIK3R1)
   05203 Viral carcinogenesis
    101121455 (PIK3R1)
   05230 Central carbon metabolism in cancer
    101121455 (PIK3R1)
   05231 Choline metabolism in cancer
    101121455 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101121455 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101121455 (PIK3R1)
   05212 Pancreatic cancer
    101121455 (PIK3R1)
   05225 Hepatocellular carcinoma
    101121455 (PIK3R1)
   05226 Gastric cancer
    101121455 (PIK3R1)
   05214 Glioma
    101121455 (PIK3R1)
   05221 Acute myeloid leukemia
    101121455 (PIK3R1)
   05220 Chronic myeloid leukemia
    101121455 (PIK3R1)
   05218 Melanoma
    101121455 (PIK3R1)
   05211 Renal cell carcinoma
    101121455 (PIK3R1)
   05215 Prostate cancer
    101121455 (PIK3R1)
   05213 Endometrial cancer
    101121455 (PIK3R1)
   05224 Breast cancer
    101121455 (PIK3R1)
   05222 Small cell lung cancer
    101121455 (PIK3R1)
   05223 Non-small cell lung cancer
    101121455 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101121455 (PIK3R1)
   05017 Spinocerebellar ataxia
    101121455 (PIK3R1)
   05020 Prion disease
    101121455 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101121455 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101121455 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    101121455 (PIK3R1)
   04931 Insulin resistance
    101121455 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101121455 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101121455 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    101121455 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101121455 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    101121455 (PIK3R1)
   05161 Hepatitis B
    101121455 (PIK3R1)
   05160 Hepatitis C
    101121455 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    101121455 (PIK3R1)
   05164 Influenza A
    101121455 (PIK3R1)
   05162 Measles
    101121455 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    101121455 (PIK3R1)
   05163 Human cytomegalovirus infection
    101121455 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101121455 (PIK3R1)
   05169 Epstein-Barr virus infection
    101121455 (PIK3R1)
   05165 Human papillomavirus infection
    101121455 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101121455 (PIK3R1)
   05142 Chagas disease
    101121455 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101121455 (PIK3R1)
   01524 Platinum drug resistance
    101121455 (PIK3R1)
   01522 Endocrine resistance
    101121455 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101121455 (PIK3R1)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101121455 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF4201 Laminin_I Lant_dehydr_C Mod_r PI_PP_I
Other DBs
NCBI-GeneID: 101121455
NCBI-ProteinID: XP_004016968
Ensembl: ENSOARG00000005870
UniProt: A0A6P3EN73
LinkDB
Position
16
AA seq 454 aa
MYNTVWNMEDLDLEYAKTDINCGTDLMFYIEMDPPALPPKPPKPTTVANNGMNNNMSLQD
AEWYWGDISREEVNEKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKY
GFSDPLTFNSVVELINHYRNESLAQYNPKLDVKLLYPVSKYQQDQVVKEDNIEAVGKKLH
EYNTQFQEKSREYDRLYEDYTRTSQEIQMKRTAIEAFNETIKIFEEQCQTQERYSKEYIE
KFKREGNETEIQRIMHNYEKLKSRISEIVDSRRRLEEDLKKQAAEYREIDKRMNSIKPDL
IQLRKTRDQYLMWLTQKGVRQKKLNEWLGNENTEDQYSLVEDDEDLPHHDEKTWNVGSSN
RNKAENLLRGKRDGTFLVRESSKQGCYACSVVVDGEVKHCVINKTATGYGFAEPYNLYSS
LKELVLHYQHTSLVQHNDSLNVTLAYPVYAQQRR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtacaacactgtttggaatatggaagacctggatttagaatatgctaagacagatata
aattgtggcacagacttgatgttttatatagaaatggatccaccagcactgcctcccaaa
ccaccaaaacccactactgtagccaacaacggtatgaataacaatatgtctttacaagat
gctgaatggtactggggagatatctcgagggaagaagtgaatgaaaaacttcgagataca
gctgacgggacctttttggtacgagacgcatctactaaaatgcatggggattacactctt
acactaaggaaaggaggaaataacaaattaatcaaaatatttcaccgagatgggaaatat
ggcttctctgacccattaaccttcaactctgtggttgaactaataaaccactaccggaat
gaatctctagctcagtataatcccaaactggatgtgaaattactttatccagtatccaaa
taccaacaggatcaagttgtcaaagaagataatattgaagctgtagggaaaaaattacat
gaatataacactcaatttcaagaaaaaagtcgggaatatgatagattatatgaagactat
acccgaacttcccaggaaatccaaatgaaaagaacagctattgaagcatttaatgaaacc
ataaaaatatttgaagaacagtgccaaacccaggagcggtacagcaaagaatacatagaa
aagttcaaacgtgaaggcaatgagacggaaatccaaaggattatgcataattacgaaaag
ttgaagtctcgaatcagtgaaattgtcgacagcagaaggagattggaagaggacttgaag
aagcaggcggctgagtatcgtgagattgacaaacgcatgaacagcatcaaaccagacctc
attcagctaagaaagacgagagaccaatacttgatgtggttgactcagaaaggtgtccgg
cagaagaaattgaatgagtggctgggcaatgaaaacactgaagaccaatattcactggta
gaagatgatgaggatttgccccaccatgacgagaagacttggaatgttggaagcagcaac
cgaaacaaagctgaaaacctgttgcgagggaagcgagacggcacttttcttgtccgggaa
agcagtaaacagggctgctacgcctgctctgtggtggtggacggtgaggtcaagcactgc
gtcatcaacaagacggccacgggctacggcttcgccgagccctacaacctgtacagctcc
ctcaaggagctcgtgctccactaccagcacacgtccctcgtgcagcacaacgactccctg
aacgtcacactagcctacccggtgtacgcgcagcagaggcgatga

KEGG   Ovis aries (sheep): 101123247
Entry
101123247         CDS       T03117                                 

Gene name
PIK3R3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas01524  Platinum drug resistance
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04070  Phosphatidylinositol signaling system
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04152  AMPK signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04611  Platelet activation
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04625  C-type lectin receptor signaling pathway
oas04630  JAK-STAT signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04670  Leukocyte transendothelial migration
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04750  Inflammatory mediator regulation of TRP channels
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04930  Type II diabetes mellitus
oas04931  Insulin resistance
oas04932  Non-alcoholic fatty liver disease
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04960  Aldosterone-regulated sodium reabsorption
oas04973  Carbohydrate digestion and absorption
oas05010  Alzheimer disease
oas05017  Spinocerebellar ataxia
oas05020  Prion disease
oas05100  Bacterial invasion of epithelial cells
oas05135  Yersinia infection
oas05142  Chagas disease
oas05146  Amoebiasis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05171  Coronavirus disease - COVID-19
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05218  Melanoma
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101123247 (PIK3R3)
   04014 Ras signaling pathway
    101123247 (PIK3R3)
   04015 Rap1 signaling pathway
    101123247 (PIK3R3)
   04370 VEGF signaling pathway
    101123247 (PIK3R3)
   04630 JAK-STAT signaling pathway
    101123247 (PIK3R3)
   04668 TNF signaling pathway
    101123247 (PIK3R3)
   04066 HIF-1 signaling pathway
    101123247 (PIK3R3)
   04068 FoxO signaling pathway
    101123247 (PIK3R3)
   04070 Phosphatidylinositol signaling system
    101123247 (PIK3R3)
   04072 Phospholipase D signaling pathway
    101123247 (PIK3R3)
   04071 Sphingolipid signaling pathway
    101123247 (PIK3R3)
   04024 cAMP signaling pathway
    101123247 (PIK3R3)
   04151 PI3K-Akt signaling pathway
    101123247 (PIK3R3)
   04152 AMPK signaling pathway
    101123247 (PIK3R3)
   04150 mTOR signaling pathway
    101123247 (PIK3R3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101123247 (PIK3R3)
  09143 Cell growth and death
   04210 Apoptosis
    101123247 (PIK3R3)
   04218 Cellular senescence
    101123247 (PIK3R3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101123247 (PIK3R3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101123247 (PIK3R3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101123247 (PIK3R3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101123247 (PIK3R3)
   04613 Neutrophil extracellular trap formation
    101123247 (PIK3R3)
   04620 Toll-like receptor signaling pathway
    101123247 (PIK3R3)
   04625 C-type lectin receptor signaling pathway
    101123247 (PIK3R3)
   04650 Natural killer cell mediated cytotoxicity
    101123247 (PIK3R3)
   04660 T cell receptor signaling pathway
    101123247 (PIK3R3)
   04662 B cell receptor signaling pathway
    101123247 (PIK3R3)
   04664 Fc epsilon RI signaling pathway
    101123247 (PIK3R3)
   04666 Fc gamma R-mediated phagocytosis
    101123247 (PIK3R3)
   04670 Leukocyte transendothelial migration
    101123247 (PIK3R3)
   04062 Chemokine signaling pathway
    101123247 (PIK3R3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101123247 (PIK3R3)
   04923 Regulation of lipolysis in adipocytes
    101123247 (PIK3R3)
   04929 GnRH secretion
    101123247 (PIK3R3)
   04915 Estrogen signaling pathway
    101123247 (PIK3R3)
   04914 Progesterone-mediated oocyte maturation
    101123247 (PIK3R3)
   04917 Prolactin signaling pathway
    101123247 (PIK3R3)
   04926 Relaxin signaling pathway
    101123247 (PIK3R3)
   04935 Growth hormone synthesis, secretion and action
    101123247 (PIK3R3)
   04919 Thyroid hormone signaling pathway
    101123247 (PIK3R3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101123247 (PIK3R3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101123247 (PIK3R3)
  09156 Nervous system
   04725 Cholinergic synapse
    101123247 (PIK3R3)
   04722 Neurotrophin signaling pathway
    101123247 (PIK3R3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101123247 (PIK3R3)
  09158 Development and regeneration
   04360 Axon guidance
    101123247 (PIK3R3)
   04380 Osteoclast differentiation
    101123247 (PIK3R3)
  09149 Aging
   04211 Longevity regulating pathway
    101123247 (PIK3R3)
   04213 Longevity regulating pathway - multiple species
    101123247 (PIK3R3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101123247 (PIK3R3)
   05206 MicroRNAs in cancer
    101123247 (PIK3R3)
   05205 Proteoglycans in cancer
    101123247 (PIK3R3)
   05203 Viral carcinogenesis
    101123247 (PIK3R3)
   05230 Central carbon metabolism in cancer
    101123247 (PIK3R3)
   05231 Choline metabolism in cancer
    101123247 (PIK3R3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101123247 (PIK3R3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101123247 (PIK3R3)
   05212 Pancreatic cancer
    101123247 (PIK3R3)
   05225 Hepatocellular carcinoma
    101123247 (PIK3R3)
   05226 Gastric cancer
    101123247 (PIK3R3)
   05214 Glioma
    101123247 (PIK3R3)
   05221 Acute myeloid leukemia
    101123247 (PIK3R3)
   05220 Chronic myeloid leukemia
    101123247 (PIK3R3)
   05218 Melanoma
    101123247 (PIK3R3)
   05211 Renal cell carcinoma
    101123247 (PIK3R3)
   05215 Prostate cancer
    101123247 (PIK3R3)
   05213 Endometrial cancer
    101123247 (PIK3R3)
   05224 Breast cancer
    101123247 (PIK3R3)
   05222 Small cell lung cancer
    101123247 (PIK3R3)
   05223 Non-small cell lung cancer
    101123247 (PIK3R3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101123247 (PIK3R3)
   05017 Spinocerebellar ataxia
    101123247 (PIK3R3)
   05020 Prion disease
    101123247 (PIK3R3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101123247 (PIK3R3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101123247 (PIK3R3)
   04932 Non-alcoholic fatty liver disease
    101123247 (PIK3R3)
   04931 Insulin resistance
    101123247 (PIK3R3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101123247 (PIK3R3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101123247 (PIK3R3)
   05100 Bacterial invasion of epithelial cells
    101123247 (PIK3R3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101123247 (PIK3R3)
   05170 Human immunodeficiency virus 1 infection
    101123247 (PIK3R3)
   05161 Hepatitis B
    101123247 (PIK3R3)
   05160 Hepatitis C
    101123247 (PIK3R3)
   05171 Coronavirus disease - COVID-19
    101123247 (PIK3R3)
   05164 Influenza A
    101123247 (PIK3R3)
   05162 Measles
    101123247 (PIK3R3)
   05168 Herpes simplex virus 1 infection
    101123247 (PIK3R3)
   05163 Human cytomegalovirus infection
    101123247 (PIK3R3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101123247 (PIK3R3)
   05169 Epstein-Barr virus infection
    101123247 (PIK3R3)
   05165 Human papillomavirus infection
    101123247 (PIK3R3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101123247 (PIK3R3)
   05142 Chagas disease
    101123247 (PIK3R3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101123247 (PIK3R3)
   01524 Platinum drug resistance
    101123247 (PIK3R3)
   01522 Endocrine resistance
    101123247 (PIK3R3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101123247 (PIK3R3)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101123247 (PIK3R3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 Cupin_8 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 101123247
NCBI-ProteinID: XP_004001976
Ensembl: ENSOARG00000002180
UniProt: W5NVV5 A0A6P3E684
LinkDB
Position
1
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAITNGIKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELISHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRKEGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagccattacaaatggaataaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatttcaagggaggaggtaaatgacaaattacgg
gacatgccagatggtaccttcttggtcagagatgcctcaaccaaaatgcagggagattac
actttgaccttgcggaagggaggcaataataagctaataaagatttatcatcgagatggt
aaatatggcttttctgatcctctgacatttaattctgtggtggagctcattagccactat
catcatgaatctcttgcccagtacaatcccaaacttgatgtgaaactgatgtacccagtg
tccagataccaacaggatcagttggtaaaagaagataatattgatgccgtcggtaaaaaa
ctgcaggagtatcactctcagtatcaggaaaagagtaaagaatatgacagactatatgaa
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcttttaat
gaaacaattaaaatatttgaagagcagtgtcatacacaagaacaacatagcaaagaatat
attgagcgatttcgaaaagaagggaatgaaaaggaaattgaacgaattatgatgaattat
gacaagttgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctcgaacaggat
ttgaagaaacaagctttggataaccgagaaatagacaaaaaaatgaatagtatcaaacct
gacctgatccagctgcgcaagatcagagatcagcaccttgtgtggctcaatcacaaagga
gtgagacagaagcgcctaaatgcctggctgggaatcaagaatgaggatgctgatgagacc
tattttatcaatgaggaagatgaaaacctgccccattatgatgagaaaacctggtttgtt
gaggatatcaaccgagtacaagcagaggacttgctttatgggaaacctgacggtgcattc
ttaatccgtgagagtagcaagaaaggatgttatgcttgctctgtggtcgccgacggagag
gtgaagcactgcgtcatctacagcactgctcggggctacggcttcgcagagccctacaac
ctgtacagctccctgaaggagctggtgctccactaccagcagacgtccctcgtgcagcac
aacgactctctcaacgtcaggctcgcctaccctgtccacgcacagatgccctcgctctgc
agataa

DBGET integrated database retrieval system