KEGG   Ovis aries (sheep): 101110136
Entry
101110136         CDS       T03117                                 

Gene name
EP300
Definition
(RefSeq) LOW QUALITY PROTEIN: histone acetyltransferase p300
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04310  Wnt signaling pathway
oas04330  Notch signaling pathway
oas04350  TGF-beta signaling pathway
oas04520  Adherens junction
oas04630  JAK-STAT signaling pathway
oas04720  Long-term potentiation
oas04916  Melanogenesis
oas04919  Thyroid hormone signaling pathway
oas04922  Glucagon signaling pathway
oas04935  Growth hormone synthesis, secretion and action
oas05016  Huntington disease
oas05152  Tuberculosis
oas05161  Hepatitis B
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05206  MicroRNAs in cancer
oas05211  Renal cell carcinoma
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101110136 (EP300)
   04330 Notch signaling pathway
    101110136 (EP300)
   04350 TGF-beta signaling pathway
    101110136 (EP300)
   04630 JAK-STAT signaling pathway
    101110136 (EP300)
   04066 HIF-1 signaling pathway
    101110136 (EP300)
   04068 FoxO signaling pathway
    101110136 (EP300)
   04024 cAMP signaling pathway
    101110136 (EP300)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101110136 (EP300)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101110136 (EP300)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101110136 (EP300)
   04935 Growth hormone synthesis, secretion and action
    101110136 (EP300)
   04919 Thyroid hormone signaling pathway
    101110136 (EP300)
   04916 Melanogenesis
    101110136 (EP300)
  09156 Nervous system
   04720 Long-term potentiation
    101110136 (EP300)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101110136 (EP300)
   05206 MicroRNAs in cancer
    101110136 (EP300)
   05203 Viral carcinogenesis
    101110136 (EP300)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101110136 (EP300)
   05215 Prostate cancer
    101110136 (EP300)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101110136 (EP300)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101110136 (EP300)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101110136 (EP300)
   05161 Hepatitis B
    101110136 (EP300)
   05164 Influenza A
    101110136 (EP300)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101110136 (EP300)
   05165 Human papillomavirus infection
    101110136 (EP300)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101110136 (EP300)
   03036 Chromosome and associated proteins [BR:oas03036]
    101110136 (EP300)
   03029 Mitochondrial biogenesis [BR:oas03029]
    101110136 (EP300)
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101110136 (EP300)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    101110136 (EP300)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101110136 (EP300)
Mitochondrial biogenesis [BR:oas03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101110136 (EP300)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 101110136
NCBI-ProteinID: XP_004007059
Ensembl: ENSOARG00000017943
UniProt: A0A6P3EBF5
LinkDB
Position
3
AA seq 2412 aa
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSATGMMSSPVNQPAMGMNTGMNAGMNPGMLT
AGSGQGMMPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQMGASGLGLQIPTKSVLPNSLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVAPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNPQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQPSNLLSDSMLHSAINS
QNPMMSDNGSVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAASMVPVMNTGPNMGQPQPGMTSNGPLPDPSMIRGNVPNQMMPRVTPQPGLNQFGQMNM
PQPPIGPRQTSPLQHHVQLAQTGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTNM
PLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQPALHQNSPSPVPSRTP
TPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQSQVLHPPPRQTPTPPPTQLPPQVQPS
LPAAPSVDQAQQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVSSQAAPEKHPSQEVRPEPKMEVEAPEPADTQPEGMPEPKAEDCKVEPTESEERGTEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKTARTRKENKFSAKRLPSTRLGTFLENRVNEFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDILKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNXKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNNQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPT
GQQPTTPQTPQPPPPSQPQPTPPNNMPPYLPRTQAAGPVSQGKAAGQVTPPTPPQTAQPP
LPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPG
GHLEPGMGPTGMQQQPPWAQGGLPPPQQLQSGMPRPAMMSVSQHGQPLNMPPQTGLGQVG
VSPLKPGTVSQQALQNLLRTLRSPSSPMQQQQVLSILHANPQLLAAFIKQRAAKYANSNP
QPLPGQPGLQPPAMPGQQGVHSSPAMQNLNPMQAGVPRAGLPQQPTQQQQLPPPMGGMSP
QAQQMNMNHSTMPSQFRDILRRQQMLQQQQQGAGPGMGPGLANHNQFQPPQGVGYPAPQQ
QPPPRMQHHMQQMPQGNMGQMGQLPQALGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQ
QHMLPSQAQSPHLQGQQIPSLSNQVRSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSP
QTSSPHPGLVAAQGNPMEQGHFASPDQNSMLSQLASNPGMANLHGASATDLGLGTDNSDL
NSNLSQSTLDIH
NT seq 7239 nt   +upstreamnt  +downstreamnt
atggccgagaatgtcgtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtccgccagcgatggcacagattttggctctctgtttgacttggag
cacgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagtacaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggtagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaagcccaacagaacagccctggattaggtttgataaatagc
atggtcaaaagcccaatggcccaggcaggcttgacttctcccaacatggggatgggcact
agtggaccaaatcagggtcccacgccgtctgcaacaggtatgatgagcagtccagtcaat
cagcctgccatgggaatgaacacggggatgaatgctggcatgaatcctggaatgttgact
gccggcagtggccaagggatgatgcctaatcaagtcatgaacggttcaattggagcaggc
cgggggcgacctaatatgcagtacccaaacccgggcatgggaaatgctggcaacttaatg
actgagccgctgcagcaaggctctccccagatgggaggacagacgggactgagaggcccc
cagcctcttaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagatgggagccagtggccttggtctccagattccgacaaagtctgta
ctaccaaatagcttatctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaatatgggccagcagcaggccccacaggtccagcagccaggcctggtggctccggtg
gcccaggggatgggttctggggcacatacggctgatccggagaagcgcaagctcatccag
cagcagcttgtcctcctcctgcatgctcacaagtgccagcgccgggagcaggccaacggg
gaggtgaggcagtgcaaccttccccactgtcgaaccatgaagaacgtccttaaccacatg
acacactgccagtcgggcaagtcctgccaagtggcacactgtgcgtcttctcgacaaatc
atttcacactggaagaattgtacaaggcatgattgtcctgtgtgtctaccccttaaaaat
gctggagataagagaaatcaacagtcaattctgactggagcaccagttggacttggcaat
actagctctctaggggtgggtcagcagtccactcccagcctaagcactgtcagtcagatt
gatcccagctctatagaaagagcctatgcagcccttggactgccctatcaagtaaatcag
atgccgacccagccccaggtgcaagcgaagaatccgcagaaccagcagtctgggcagtct
ccccaagggatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaccgtcgaatcttctttctgactcgatgttgcattcagccataaattct
caaaacccaatgatgagtgacaatggcagtgtggcctctctgggtcctatgccaacagca
gctcaaccatccagtactggaattcggaagcaatggcatgaagatattactcaggatctt
cgaaatcatcttgtccacaaacttgttcaagccatatttcccactccggatcctgctgct
ttaaaagacagacggatggaaaacctagttgcatatgcccggaaagtggaaggggacatg
tatgaatcggcaaacaatcgagcggaatactaccacctgctagctgagaagatctataag
attcagaaggaactagaagaaaagcgaaggactagactacagaaacagaacatgctacca
agtgctgcaagcatggtgccagttatgaacacagggcctaacatggggcagccgcaacca
ggaatgacttctaatggccccctccctgatccatctatgatccgtggcaatgtgccaaac
cagatgatgcctcgggtaactccacagcctggtttgaatcaatttggccagatgaatatg
cctcagccacctatcggaccccggcaaacctctcctcttcagcaccatgtacagttagct
caaactggaacacttaacccgcctatgggctacgggcctcgcatgcagcagccttccagc
cagagccagtttcttcctcagactcaattctcaacacagggaatgaatgtaacaaatatg
cctttggctccgtctggcggtcaagcaccagtgtctcaagcacagatgtccagttcttcc
tgtcctgtgaactctcctataatgcctcccgggtctcaagggagccacattcactgtccc
cctctccctcaaccagctctgcatcagaactcaccctcccccgtacctagtcgcaccccc
acccctcaccacactccccctagcataggggctcagcagccaccagcaacagcaatccca
gcccctgttcctacgcctccagccatgccacctggcccacagtcccaggttctccatccg
cctccaagacagacgcctacgccgccgccaacacagcttcctccccaagtgcagccttcg
cttcctgctgctccctcagtcgaccaggcgcagcagcagcagcctctgtcccagcaaagc
acagcagcctctgtgcccaccccgaccgcacccctgctgcctccgcagccggcaactcca
ctttcccagccagctgtcagcatcgaagggcaggtgtcaaaccctccatccactagtagc
acagaagtgagttctcaggccgcccctgagaagcatccgtcacaggaagtaagaccggag
ccgaaaatggaagtggaggcgccagaaccagcagacactcagccggagggtatgccagag
cctaaagcagaagactgtaaagtagaacctacagaaagcgaagagcgaggcactgaatta
aaaactgagacgaaagaggaagaagaccagccaagtacttcagcgacccagtcatctcca
gccccgggacagtcgaagaagaagattttcaaaccggaagagttacggcaggcactaatg
ccaacattggaggcactttaccgacaggatccggaatcccttccctttcgtcagcctgtg
gaccctcagcttctaggaatccctgattactttgatattgtgaagagccctatggatctt
tctaccatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggat
gacatttggctcatgttcaacaatgcttggttatataatcggaaaacatcacgggtgtac
aaatactgctccaagctgtctgaggtctttgaacaagaaattgaccctgtcatgcaaagc
cttggatactgttgtggcagaaagttggagttctctccacagacactctgttgctatggc
aaacagttatgcacaatccctcgtgatgccacttactacagttatcagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccaacctcaaactacaataaataaagaacaattttcaaagagaaaaaatgatactctg
gatcctgaactgtttgttgagtgtacagagtgtgggagaaagatgcatcagatctgtgtc
cttcatcatgagatcatctggccatcgggatttgtctgtgatggttgtttaaagaagact
gcacgaactagaaaagaaaataaattttctgctaaaagactgccatctaccaggcttggg
acatttctggagaatcgtgtgaatgagtttctgaggcgacagaatcaccctgagtcagga
gaggtcactgttcgagtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatg
aaagcaagatttgtagatagtggagagatggcagaatcctttccatatcgaaccaaagcc
ctctttgccttcgaagaaatcgatggtgttgacttgtgcttctttggtatgcacgttcag
gagtatggctctgactgccctccacccaaccagaggagagtatacatatcatacctcgat
agtgttcacttcttccgtcctaaatgcttgaggactgcagtctatcatgaaatcctaatt
ggatatttggaatatgtcaagaaattaggatacacaacagggcatatttgggcgtgtccg
ccaagtgaaggagatgactacatcttccattgccacccccctgaccagaagatacccaag
cccaagcgactgcaggagtggtacaaaaagatgctcgacaaagctgtgtccgagcgaatc
gtccatgattataaggatattttaaaacaagctactgaagatcgattgacaagcgcgaag
gaattgccttactttgagggagatttctggcccaatgtcctggaagagagcattaaggaa
ctggagcaggaggaggaggagcggaagcgggaggagaacaccagcaacgagagcacagat
gtgacaaagggtgacagcaaaaacgctaaaaagaaaaacaacnaaaaaactagcaaaaac
aagagcagcctgagtcggggcaataagaagaagccaggcatgcccaacgtatccaacgac
ctctcacagaagttgtatgccaccatggagaagcacaaagaggtcttctttgtgatccgt
ctcatcgctggccctgccgccaactccctgcctcccattgttgaccccgaccccctcatc
ccctgtgacctgatggatgggcgggatgcctttctcaccctcgcaagggacaagcacctg
gagttctcatcactgcgaagagcccagtggtccaccatgtgcatgctggtggagctgcac
acccagagccaggaccgctttgtctacacctgcaacgagtgcaagcaccacgtggagact
cgctggcattgcaccgtgtgtgaggattatgacttgtgtatcacctgctacaacactaaa
aaccacgaccacaagatggagaagctcgggctggggcttgatgacgagagcaacaaccag
caggccgccgccacgcagagccccggagactcccgccgcctgagcatccagcgctgcatc
cagtcgctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccag
aagatgaagcgggtggtgcagcacaccaagggctgcaagcgcaagaccaacggcggctgc
cccatctgcaaacagctcatcgccctgtgctgctaccatgccaagcactgccaggagaac
aagtgccccgtgcccttctgcctcaacatcaagcagaagctccggcagcagcagctgcag
caccggctccagcaggcccagatgctgcgccggcggatggccagcatgcagcggactggc
gtggtggggcagcagcagggcctgccctccccgacccctgccaccccaaccacgccgaca
ggccagcagcccaccaccccgcagacaccccagcccccgcccccctctcagccccagccc
acacctcccaacaacatgccgccctacttgcccaggactcaagctgctggcccagtgtcc
cagggcaaggcagcaggccaagtgacccccccgaccccgcctcagactgctcagccccca
cttccaggacctccacctgcagcagtggaaatggccatgcagattcagagggcagccgag
acgcaacgccagatggcccatgtgcaaatctttcagcggccaatccagcaccagatgccg
cagatgactcccatggcccccatgggtatgaacccgccccccatggccagagggcctggt
ggacatttggagccagggatggggcccaccggcatgcagcagcaacccccgtgggcccag
ggaggactgcccccgccccagcagctgcagtccgggatgccccggccagccatgatgtcg
gtgtcacagcatgggcagcccctgaacatgcctccccagacgggcctgggccaggtaggt
gtgagccctctcaagccaggcactgtgtctcaacaagccttacagaacctcctgcggact
ctcaggtctcccagctcccccatgcagcagcaacaggtgctcagtatccttcatgccaac
ccccagctattggctgcgttcatcaaacagcgggctgccaagtacgccaactccaacccg
cagccgctccccgggcagccgggcctgcagcctcccgccatgccaggtcagcagggggtc
cactccagccccgccatgcagaacttgaaccccatgcaggcaggtgtcccgagggctggc
ttgccccagcagcccacacagcagcaacagctcccaccacccatgggtgggatgagcccg
caggctcagcagatgaacatgaatcacagcaccatgccctcgcaattccgagacatcttg
aggcgacagcagatgttgcagcagcagcagcagggagcggggccagggatgggcccgggg
ctggccaaccacaaccagttccagcccccgcagggcgtgggctaccctgccccacagcag
cagccgccgccacgaatgcagcaccacatgcagcagatgccgcaagggaacatgggacag
atgggccagctcccgcaggccctgggagcagaggcaggagccagtctgcaggcctaccag
cagcggctccttcagcaacagatgggctcgccggcccagcccaaccccatgagcccccag
cagcacatgctcccgagtcaggctcagtccccgcacctccaaggccagcagatcccgtct
ctctccaatcaagtgcgatctccccagcctgtcccttctccgcggccgcagtcccagccc
ccccactccagcccttccccacggatgcagcctcagccttctccacaccacgtctcccca
cagaccagttctccacatcctggactggtcgctgcccagggcaaccccatggaacaaggg
cattttgccagcccggaccagaattcgatgctctctcagctcgctagcaatccaggcatg
gcaaacctccatggtgcgagcgccacggacctgggactcggcaccgacaactcagacttg
aattcaaacctctcacagagtacactagacatacactag

KEGG   Ovis aries (sheep): 101123600
Entry
101123600         CDS       T03117                                 

Gene name
CREBBP
Definition
(RefSeq) CREB-binding protein
  KO
K04498  E1A/CREB-binding protein [EC:2.3.1.48]
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04110  Cell cycle
oas04310  Wnt signaling pathway
oas04330  Notch signaling pathway
oas04350  TGF-beta signaling pathway
oas04520  Adherens junction
oas04630  JAK-STAT signaling pathway
oas04720  Long-term potentiation
oas04916  Melanogenesis
oas04919  Thyroid hormone signaling pathway
oas04922  Glucagon signaling pathway
oas04935  Growth hormone synthesis, secretion and action
oas05016  Huntington disease
oas05152  Tuberculosis
oas05161  Hepatitis B
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05206  MicroRNAs in cancer
oas05211  Renal cell carcinoma
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101123600 (CREBBP)
   04330 Notch signaling pathway
    101123600 (CREBBP)
   04350 TGF-beta signaling pathway
    101123600 (CREBBP)
   04630 JAK-STAT signaling pathway
    101123600 (CREBBP)
   04066 HIF-1 signaling pathway
    101123600 (CREBBP)
   04068 FoxO signaling pathway
    101123600 (CREBBP)
   04024 cAMP signaling pathway
    101123600 (CREBBP)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101123600 (CREBBP)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    101123600 (CREBBP)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101123600 (CREBBP)
   04935 Growth hormone synthesis, secretion and action
    101123600 (CREBBP)
   04919 Thyroid hormone signaling pathway
    101123600 (CREBBP)
   04916 Melanogenesis
    101123600 (CREBBP)
  09156 Nervous system
   04720 Long-term potentiation
    101123600 (CREBBP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101123600 (CREBBP)
   05206 MicroRNAs in cancer
    101123600 (CREBBP)
   05203 Viral carcinogenesis
    101123600 (CREBBP)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    101123600 (CREBBP)
   05215 Prostate cancer
    101123600 (CREBBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    101123600 (CREBBP)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101123600 (CREBBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101123600 (CREBBP)
   05161 Hepatitis B
    101123600 (CREBBP)
   05164 Influenza A
    101123600 (CREBBP)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101123600 (CREBBP)
   05165 Human papillomavirus infection
    101123600 (CREBBP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101123600 (CREBBP)
   03036 Chromosome and associated proteins [BR:oas03036]
    101123600 (CREBBP)
   03029 Mitochondrial biogenesis [BR:oas03029]
    101123600 (CREBBP)
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101123600 (CREBBP)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain CBP
    101123600 (CREBBP)
Chromosome and associated proteins [BR:oas03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101123600 (CREBBP)
Mitochondrial biogenesis [BR:oas03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101123600 (CREBBP)
SSDB
Motif
Pfam: HAT_KAT11 KIX Creb_binding zf-TAZ DUF902 Bromodomain ZZ KIX_2 Npa1
Other DBs
NCBI-GeneID: 101123600
NCBI-ProteinID: XP_027817381
Ensembl: ENSOARG00000002484
UniProt: A0A6P7DF77
LinkDB
Position
24
AA seq 2436 aa
MAENLLDGPPNPKRAKLSSPGFSANDSTDFGSLFDLENDLPDELIPNGGELSLLNSGNLV
PDAASKHKQLSELLRGGSSSSINPGIGNVSASSPAQQGLGGQAQGQPSSANMASLGAMGK
SPLNQGDSSAPSLPKQAASTSGPTPPASQALNPQAQKQVGLVTSSPATSQTGPGICMNAN
FNQTHPGLLNSNSGHSLMNQAQQGQAQVMNGSLGAAGRGRGAGMPYPTPAMQGATSSVLA
ETLTQVSPQMASHAGLSTAQAGGMSKMGMTGNTSPFGQAFSQTGGQQMGAPGVNPQLPSK
QSMVNSLPPFAADIKNASVTNVPNMSQMQTSVGIVPTQAIATGPTADPEKRKLIQQQLVL
LLHAHKCQRREQANGEVRACSLPHCRTMKNVLNHMTHCQAGKACQVAHCASSRQIISHWK
NCTRHDCPVCLPLKNASDKRNQQTILGSPASGIQNTIGSVGTGQQNATSLSNPNPIDPSS
MQRAYAALGLPYLNQPQTQLQPQVPGQQPAQPQTHQQMRSLNPLGNNPMNIPAGGITTDQ
QPPNLISESALPTSLGATNPLMNDGSNSGNIGTLSTIPAAAPPSSTGVRKSWHEHVTQDL
RSHLVHKLVQAIFPTPDPAALKDRRMENLVAYAKKVEGDMYESANSRDEYYHLLAEKIYK
IQKELEEKRRSRLHKQGILGNQPALPAPGTQPPGIPQAQPVRPPNGPMPLPVNRMQVSQG
MNSFNPISLGNVQLPQAPMGPRAASPMNHSVPMNSMGSVPGMAISPSRMPQPPNMMGAHA
NSMMAQAPAQSQFLPQSQFPSSSGALSVSSVGMGQPAAQAGVPQGQVPGAALPNPLNMLG
PQASQLPCPPVTQPPLHQTPPPASTAAGMPSLQHPAAPGVTPPQPAAPTQPSTPASSSGQ
TPTPTPGSVPSASQTQSTPTVQAAAQAQVTPQPQTPVQPPSVATPQSSQQQPTPVHTQPP
GTPLSQTAASIDNRVPTPSSVASAETNSQQPGPEVPLLEMKAEIKTEDTEPDAGEPKGEP
GAAMMEEDLQGSSQVKEETDPTEQKSEPMEVDEKKTEVKVEAKEEEEGSTNGTASQSTSP
SQPRKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIPDYFDIVKNPMDLST
IKRKLDTGQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKFCSKLAEVFEQEIDPVMQSLG
YCCGRKYEFSPQTLCCYGKQLCTIPRDAAYYSYQNRYHFCEKCFTEIQGENVTLGDDPSQ
PQTTISKDQFEKKKNDTLDPEPFVDCKECGRKMHQICVLHYDIIWPSGFVCDNCLKKTGR
TRKENKFSAKRLQTTRLGNHLEDRVNKFLRRQNHPEAGEVFVRVVASSDKTVEVKPGMKS
RFVDSGEMSESFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSDCPPPNTRRVYISYLDSI
HFFRPRCLRTAVYHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPPDQKIPKPK
RLQEWYKKMLDKAFAERIIHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELE
QEEEERKKEESTAASETTEGSQGDSKNAKKKNNKKTNKNKSSISRANKKKPSMPNVSNDL
SQKLYATMEKHKEVFFVIHLHAGPVINTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWE
FSSLRRSKWSTLCMLVELHTQGQDRFVYTCNECKHHVETRWHCTVCEDYDLCINCYNTKS
HTHKMVKWGLGLDDEGGSQGEPQSKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQK
MKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQIQH
RLQQAQLMRRRMATMNTRNVPQQSLPSPTSAPPGTPTQQPSTPQTPQPPAQPQPSPVSMS
PAGFPSVTRTQPPTTVSTGKPTNQVPAPPPPAQPPPAAVEAARQIEREAQQQQHLYRVNI
NNGMPPGRTGMVTPVSQMAPVGLNVPRPSQVSGPVVPTLPAGQWQQAPIPQQQPMPGMPR
PVMSMQAQPAVAGPRMSGVQPPRSISPGALQDLLRTLKSPSSPQQQQQVLNILKSNPQLM
AAFIKQRTAKYVASQPGLQPQPGLQAQPGLHQQPGLQNLNAMQASGPRPGVPPQQQAMGG
LNPQGQALNIMNAGHNPSMASMNPQYREMLRRQLLQQQQQQQQQQQQQQQQGGAGMAGGM
AGHGQFPQPPGPAGYPPAMPQQRVQQHLPMQGSAMGPMAAPMGQLGQMGQPGLGADSTPN
IQQALQQRILQQQQMKQQMGSPGQPNPMSPQQHMLSGQPQASHLPGQQMATSLSSQVRSP
APVQSPRPQSQPPHSSPSPRIQPQPSPHHVSPQTGSPHPGLAVTMASSIDQGHLGNPEQS
AMLPQLNTPNRSALSSELSLVGDTTGDTLEKFVEGL
NT seq 7311 nt   +upstreamnt  +downstreamnt
atggccgagaacttgctggacggaccgcccaaccccaaacgagccaaactcagctctccc
ggcttctcggcgaatgacagcacagattttggatcattgtttgacttggaaaatgatctt
cccgatgagttgatccccaatggaggagaattaagccttttaaacagtgggaacctcgtt
ccagatgctgcttccaaacataaacaactgtccgagctcctgcgaggcggcagcagctcc
agcatcaacccgggaataggcaatgtgagtgccagcagccccgctcaacaaggcctcggc
ggccaggcccaggggcagcccagcagtgccaacatggccagtctgggtgccatgggcaag
agccctctgaaccagggagattcttcggcccccagcctgcccaagcaggcagccagcacc
tccgggcccactcctcctgcttcccaagcactgaatccgcaagcacaaaagcaagtgggg
ctggtaaccagcagccctgccacgtcgcagacgggacctgggatctgcatgaacgcaaac
ttcaaccagacccacccaggcctcctcaatagtaactctggccacagtttaatgaaccag
gcccagcaaggacaggcacaggtcatgaatggatctctcggggctgctggccgaggaagg
ggagctgggatgccataccctactccggccatgcagggggccacgagcagtgtgctggct
gagacgttgacccaagtttcaccgcaaatggccagtcacgcggggctgagcaccgcacag
gccggaggcatgagcaagatgggaatgactggtaacacaagtccatttggacaagccttt
agtcaaactggagggcagcagatgggagcccctggagtgaacccccagctgccgagcaag
cagagcatggtcaacagcttgcctccctttgccgcagacatcaagaacgcttcagtcacc
aacgtgccaaacatgtctcagatgcaaacatcagtgggaattgtacccacacaggcaatt
gcaacgggccccactgcagatcctgaaaaacgcaaactgatacagcagcagctggtccta
ctgcttcacgctcataaatgtcagaggcgagaacaagccaatggagaggtccgggcctgc
tcactcccacactgtcgaaccatgaaaaacgtcttgaatcacatgacgcactgtcaggct
gggaaggcttgtcaagttgcccattgtgcatcttcacgacaaatcatctctcattggaag
aactgcacacgacatgactgtcctgtttgcctccctttgaaaaatgccagtgacaagcga
aaccaacaaaccatcctggggtctccagctagtggaattcaaaacaccattggttctgtt
ggcaccggccaacagaatgccacttctttaagtaacccaaatccgatagaccccagctcc
atgcaacgagcgtatgctgctcttggactcccctacctgaaccagccccagacgcagctg
cagcctcaggttcctggccagcaaccagcacagcctcaaactcaccagcagatgaggagt
ctcaaccccctgggaaataacccaatgaacattccagcaggaggaataacaacagatcag
cagccaccaaacttgatttcagaatcagctcttccaacttcccttggggctacaaacccc
ctgatgaatgatggctcaaactctgggaacattggcacccttagcactatacctgcagca
gcacctccttccagcactggcgttcggaaaagctggcatgaacacgtcactcaggacctg
cggagccatctagtgcataaacttgtccaagccatcttcccgacacctgaccctgcagcc
ctgaaggatcgccgcatggagaacctggtggcctacgctaagaaagtagaaggggacatg
tacgagtctgccaacagcagggatgaatactatcacttactagcagagaaaatctacaag
attcaaaaagagctagaagaaaagcggagatcacgtttacacaaacaaggcatcttgggt
aaccagccagccttaccagcccccgggacacagccgcctggaataccccaggcgcagcct
gtgagacctccgaatgggcccatgcctcttccagtgaatcgtatgcaggtttctcaaggg
atgaattcatttaacccaatatccttggggaacgtacagttgccacaagcgcccatggga
ccgcgtgcggcatcccccatgaaccactctgtcccgatgaacagcatgggctctgttcca
gggatggccatttctccgtcccgaatgcctcagcctccgaacatgatgggcgcgcacgcc
aacagcatgatggcccaggcgcctgcgcagagccagttcctcccgcagagccagttcccg
tcgtccagcggggcgctgagtgtgagcagcgtgggcatggggcagccagcggcgcaggct
ggcgttccacaggggcaggtgccgggggctgctcttcccaaccccctgaacatgcttggg
ccccaggccagccagctgccttgcccaccagtgacacagccgccactgcatcagaccccg
cctcccgcctccacagccgctggcatgccgtctttgcagcacccagcagctcccggggtg
acacccccccagccggcggcgcctacccagccatcaactcccgcgtcgtcttccgggcag
actcccaccccgactcccggctccgtgcccagcgccagccagacgcagagtactcctacg
gtccaggcagctgcccaggcccaggtgaccccacagcctcagaccccagtgcagcctccg
tcggtggccaccccacagtcatcgcagcagcagccgacacccgtgcacacgcagccccct
ggcaccccgctttcccagacagcagccagcattgataacagggtccccactccatcctca
gtggccagcgccgaaaccaactcccagcagccaggccccgaggtgccactgctggagatg
aaggctgagatcaagactgaggacacagagcccgatgctggggagcccaagggagagccc
ggggctgcgatgatggaggaggacttacaaggatcttctcaagttaaagaagaaacagac
ccaacagagcagaagtcagaaccaatggaagtggatgaaaagaaaactgaagtgaaggtc
gaagctaaagaggaagaagagggcagcaccaatggcacagcctctcagtccacgtcccct
tcgcagcctcgcaagaaaatcttcaagccggaggagttgcgccaggctctgatgccaacc
ctggaagctctgtaccgacaggatccagagtccttaccttttcggcagcctgtggatccc
cagctcctgggaattccagattactttgacattgtgaagaatcccatggacctttccacc
atcaagcggaagctggatacagggcagtaccaggagccctggcagtatgtagacgacgtc
tggctcatgttcaacaacgcctggctctataatcggaagacatcccgggtctacaagttc
tgcagcaaactcgcagaggtctttgagcaggagattgaccccgtcatgcagtcccttgga
tattgctgtggacgcaagtatgagttttccccacagactctgtgctgctacgggaagcag
ctatgtacaattcctcgagatgctgcctactacagctatcagaataggtatcacttctgt
gagaagtgtttcacagagatccagggggagaatgttaccctgggtgacgacccttcacaa
ccccagacgacaatttcaaaggatcagtttgaaaagaagaaaaatgataccttagatcct
gaaccttttgttgactgcaaggagtgtggccggaagatgcatcagatttgtgttctccac
tacgacatcatctggccttcaggctttgtatgcgacaactgcttgaagaaaacgggcaga
actcgaaaagaaaacaaattcagtgctaagagactacaaaccacacggttgggaaatcac
ctggaagaccgagtcaacaagtttttgcggcgacagaatcaccccgaagccggggaggtg
tttgtccgtgtggtggccagctcagacaagacggtggaggtcaagccagggatgaagtca
cggtttgtggattctggggagatgtcggagtctttcccctacagaaccaaagcactcttt
gcctttgaggagattgatggggtggacgtgtgcttctttgggatgcatgtccaggagtac
ggctctgactgccccccaccaaacacaaggcgtgtgtatatatcttatctggacagtatt
catttcttccgaccccgatgcctccgaacagccgtttaccatgagatccttattggatat
ttagagtatgtgaagaaattggggtacgtgacagggcacatctgggcctgtcccccgagt
gaaggagatgactacatcttccactgccacccccctgatcaaaaaatccccaagccgaag
cgcctgcaggagtggtataagaagatgctggacaaggccttcgccgagcgcatcatccat
gactacaaggacattttgaaacaagcaactgaagacaggctcaccagcgccaaggagctg
ccctactttgagggggacttctggcctaacgtgctggaggagagcattaaggagctggag
caggaggaggaggaaagaaagaaggaggagagcaccgcggccagtgagaccacggagggc
agccagggcgacagcaagaacgccaagaaaaagaacaacaagaaaaccaacaagaataaa
agcagcatcagccgcgccaacaagaagaagcccagcatgcccaatgtgtccaacgacctg
tcccagaaactctacgccaccatggagaagcacaaagaggtcttctttgtgatccacctc
cacgctgggcccgtcatcaacacgctgccccccatcgtcgaccccgaccccctgctcagc
tgtgacctcatggatgggcgggatgccttcctcacactggcccgggacaagcactgggag
ttctcctccttgcggcgctccaagtggtccacgctgtgcatgctggtggagctgcacacc
cagggccaggaccgcttcgtctacacctgcaacgagtgcaagcaccacgtggagacgcgc
tggcactgcaccgtgtgcgaggactacgacctctgcatcaactgctacaacacgaagagc
cacacccacaagatggtgaagtgggggctgggcctggacgacgagggcggcagccaaggc
gagccgcagtccaagagcccccaggagtcgcggcgcctgagcatccagcgctgcatccag
tcgctggtgcacgcctgccagtgccgcaacgccaactgctcactgccgtcctgccagaag
atgaagcgggtggtgcagcacaccaagggctgtaagcgcaagaccaacggcggctgcccg
gtgtgcaagcagctcatcgccctctgctgctaccacgccaaacactgccaagaaaacaag
tgccccgtgcccttctgcctcaacatcaaacacaagctccgccagcagcagatccagcac
cgcctgcagcaggcccagctcatgcgccggcggatggccaccatgaacacccgcaacgtg
cctcagcagagcctgccttcccctacctcagcgccgcccgggacccccacgcagcagccc
agcacgccccagacgccgcagccccccgcccagccccagccctcgcctgtgagcatgtca
ccagccggcttccccagcgtgacccggactcagccacccacgacggtgtccaccgggaag
cccaccaaccaggtgccagccccgccgccccccgcccagcccccacccgcggcggtggag
gctgcccggcagatcgagcgggaggcccagcagcagcagcacctgtaccgggtgaacatc
aacaacggcatgcccccggggcgcacgggcatggtgaccccagttagccagatggccccc
gtgggcctgaacgtgccccggcccagccaggtcagcgggcccgtcgtgcccaccctgccg
gccgggcagtggcagcaggcacccatcccccagcagcagccgatgccgggcatgccccgg
cccgtgatgtccatgcaggcccagccggccgtggccgggccccggatgtccggcgtgcag
ccgccccggagcatctcacccggtgccctccaggacctgctgcggaccctgaagtcgccc
agctccccgcagcagcagcagcaggtgctcaacatcctcaagtccaaccctcagctgatg
gcagctttcatcaaacagcgcacggccaagtacgtggccagccagcccggcctgcagcca
cagcccggcctccaggcccagcccggcctgcaccagcagcccggcctgcagaacctgaac
gccatgcaagccagcgggccacggcctggcgtgcctccgcagcagcaggccatgggcggc
ctgaacccccagggccaggccctgaacatcatgaacgcaggccacaaccccagcatggca
agtatgaacccgcagtaccgagagatgctgaggaggcagctcctgcagcagcagcagcaa
caacagcagcagcagcagcagcagcagcagcagggcggcgccggcatggctgggggcatg
gcagggcacggccagttcccacagcccccgggccccgcgggctacccccctgccatgccg
cagcagcgggtgcagcagcacctccccatgcagggcagcgccatgggcccgatggcagct
ccgatggggcagctcggccagatggggcagcctgggctgggcgcagacagcacccccaac
atccagcaggccctgcagcagcggattctgcagcagcagcagatgaaacagcagatgggg
tccccaggccagccgaaccccatgagcccccagcagcacatgctctcaggacagcctcag
gcctcgcacctccccggccagcaaatggccacgtcccttagtagccaggtgcggtctccg
gcccctgtccagtctccgcggccccagtcccagcctccacattccagcccgtcgccacgg
atacagccccagccttcaccgcaccacgtctcgccccagactggctccccccacccagga
ctcgcagtcaccatggccagctccatagatcagggacacttggggaaccccgaacagagt
gcaatgctcccgcagctgaacacccctaaccggagtgcgttgtccagtgagctgtccctg
gtcggcgacaccacgggagacaccctagaaaagtttgtggagggtttgtag

DBGET integrated database retrieval system