KEGG   Ovis aries (sheep): 101110646
Entry
101110646         CDS       T03117                                 

Gene name
ERG
Definition
(RefSeq) transcriptional regulator ERG isoform X1
  KO
K09435  transcriptional regulator ERG
Organism
oas  Ovis aries (sheep)
Pathway
oas05202  Transcriptional misregulation in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101110646 (ERG)
  09162 Cancer: specific types
   05215 Prostate cancer
    101110646 (ERG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101110646 (ERG)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    101110646 (ERG)
SSDB
Motif
Pfam: Ets SAM_PNT SAM_3 SAM_2 SAM_1
Other DBs
NCBI-GeneID: 101110646
NCBI-ProteinID: XP_027817560
UniProt: A0A6P7DFL4
LinkDB
Position
1
AA seq 497 aa
MLPSFCGTFRLSTGHSHNSHGGNSEALSVVSEDQSLFECAYGTPHLPKTDMTASSSGDYG
QTSKMSPRVPQQDWLSQPPARVTIKMECNPNQVNGSRNSPDECSMAKGGKMVGSPDTVGM
NYSSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVDILLFQN
IDGKELCKMTKDDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHAR
NTGGAAFIFPNTSVYPEATQRITTRPDLPYEPPRRSAWTSHGHPAPQSKAAQPSPSTVPK
TEDQRPQLDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSNCITWEGTNGEFKMT
DPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
PPESSLYKYPSDLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYP
SARLPTSHMPSHLGTYY
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgttgccttcattttgtggaaccttcaggctgagcacggggcattctcataactcgcac
ggtggtaattcggaagcgttatcggtcgtgagcgaggaccagtcactgtttgagtgcgcc
tacggcacgccacacctgcccaagacggacatgaccgcgtcctcctccggcgactatgga
cagacatccaagatgagcccgcgtgtccctcagcaggactggctgtctcaacccccagcc
agggtcaccatcaagatggaatgtaaccctaaccaggtgaacggctcaaggaactcccct
gatgagtgcagcatggccaaaggtgggaagatggtgggcagcccagacaccgtcgggatg
aactacagcagctacatggaggagaagcacatgccacccccaaacatgaccaccaacgag
cgccgcgtcatcgtccccgcagatcccacgctatggagtacagaccatgtccggcagtgg
ctggagtgggcagtcaaagaatacgggcttccggacgttgacatcttattattccagaat
atcgacgggaaggagctgtgcaagatgaccaaagatgactttcagaggctcaccccgagc
tacaacgctgacatcctcctgtcgcacctccactacctcagagagacacctcttccacat
ttgacttcagatgatgttgataaagccttacaaaactctccacggttaatgcatgctaga
aacacagggggtgcagcttttattttcccaaatacttcagtatatcccgaagctacgcaa
agaattacaactaggccagatttaccttatgaaccacccaggagatccgcctggaccagc
cacggccaccccgccccccagtcgaaagctgctcagccgtctccttccacagtgcccaaa
actgaagaccagcgtcctcagctagatccttaccagattcttggacccacaagtagccgc
cttgcaaatccagggagcgggcagatccagctttggcagttcctgctggagcttctgtct
gacagctcgaattccaactgcatcacctgggagggcaccaacggggagttcaagatgacc
gacccggacgaggtggcgcggcgctggggggagcggaagagcaagcccaacatgaactat
gacaagctcagccgggccctccgctactactatgacaagaacatcatgaccaaagtccac
gggaagcgctacgcgtacaagttcgacttccacgggatcgcccaggccctgcagccccac
cccccggagtcctctctgtacaagtacccctcggacctcccctacatgggctcctatcac
gcccacccgcagaagatgaactttgtggccccccaccctccggccctccccgtgacgtca
tccagctttttcgctgccccgaacccgtactggaattcacccacaggggggatctacccc
agcgctaggctcccaaccagccatatgccttcgcatctgggcacttactactaa

DBGET integrated database retrieval system