KEGG   Ovis aries (sheep): 101110953
Entry
101110953         CDS       T03117                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
oas  Ovis aries (sheep)
Pathway
oas01524  Platinum drug resistance
oas04115  p53 signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04215  Apoptosis - multiple species
oas04370  VEGF signaling pathway
oas04919  Thyroid hormone signaling pathway
oas05010  Alzheimer disease
oas05012  Parkinson disease
oas05014  Amyotrophic lateral sclerosis
oas05016  Huntington disease
oas05020  Prion disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05134  Legionellosis
oas05145  Toxoplasmosis
oas05152  Tuberculosis
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05162  Measles
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05168  Herpes simplex virus 1 infection
oas05169  Epstein-Barr virus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05210  Colorectal cancer
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05215  Prostate cancer
oas05222  Small cell lung cancer
oas05223  Non-small cell lung cancer
oas05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    101110953 (CASP9)
   04151 PI3K-Akt signaling pathway
    101110953 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101110953 (CASP9)
   04215 Apoptosis - multiple species
    101110953 (CASP9)
   04115 p53 signaling pathway
    101110953 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101110953 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101110953 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101110953 (CASP9)
   05212 Pancreatic cancer
    101110953 (CASP9)
   05215 Prostate cancer
    101110953 (CASP9)
   05213 Endometrial cancer
    101110953 (CASP9)
   05222 Small cell lung cancer
    101110953 (CASP9)
   05223 Non-small cell lung cancer
    101110953 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101110953 (CASP9)
   05012 Parkinson disease
    101110953 (CASP9)
   05014 Amyotrophic lateral sclerosis
    101110953 (CASP9)
   05016 Huntington disease
    101110953 (CASP9)
   05020 Prion disease
    101110953 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    101110953 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101110953 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101110953 (CASP9)
   05152 Tuberculosis
    101110953 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101110953 (CASP9)
   05161 Hepatitis B
    101110953 (CASP9)
   05160 Hepatitis C
    101110953 (CASP9)
   05164 Influenza A
    101110953 (CASP9)
   05162 Measles
    101110953 (CASP9)
   05168 Herpes simplex virus 1 infection
    101110953 (CASP9)
   05163 Human cytomegalovirus infection
    101110953 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101110953 (CASP9)
   05169 Epstein-Barr virus infection
    101110953 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101110953 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101110953 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:oas01009]
    101110953 (CASP9)
   01002 Peptidases and inhibitors [BR:oas01002]
    101110953 (CASP9)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     101110953 (CASP9)
Protein phosphatases and associated proteins [BR:oas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101110953 (CASP9)
Peptidases and inhibitors [BR:oas01002]
 Cysteine peptidases
  Family C14: caspase family
   101110953 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 101110953
NCBI-ProteinID: XP_012042878
Ensembl: ENSOARG00000009701
UniProt: A0A6P3TIV6 W5PIY5
LinkDB
Position
12
AA seq 452 aa
MDEADRLLLRRYRLPLVGELQVASLWDALLSRELFTPDMIEDIQRAGSGSRRDQARQLIL
DLETRGSQALPLFISCLEDTGQDTLASLLKTSRQAAKQDVEAIRPLDLKPVVLGPEGLKP
EELRVMKQDPSKPSQGKLAPVVLGPEELWPAKLRPEVLRPEVPRPGDIGSGGFTDVCPRD
RAKGNADLAYVLNADPCGHCLIINNVNFCRESGLMTRTGSNIDCERMQRRFHLLQLAVEV
RCDLTAKQMVQALTQLARRDHGALDCCVVVILSHGCQASHRQFPGAVYGTDGCPVSVERI
VNTFNGTGCPSLGGKPKLFFIQACGGEQKDHGFEVASTSPEDETPNSNPETDATPFQEGP
RSTDEPDAVSSLPTPSDILVSYSTFPGFVSWRDPKSGSWYIETLDSIFEQWAHCEDLQTL
LLRVANAVSVKGIYKQIPGCFNFLRKKLFFKT
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggacgaggctgaccggctgctcctgcggcggtaccggttgccgctggtcggtgagctg
caggttgcctcgctttgggacgccctgctgagccgcgagctcttcactcccgacatgatc
gaggacattcagagggcaggctcaggatctcggcgcgatcaggccaggcagctgatccta
gatctagagactcgagggagtcaggcccttcctttgttcatctcctgcttggaggacaca
ggccaggacactctggcttcattattgaagaccagcagacaagcagcaaaacaggatgtg
gaggccatcagacccctggatcttaagccagtggtgctcggaccagagggcctcaaacca
gaggagctgagagtgatgaagcaggacccatcaaagccaagccaaggaaaactcgctcca
gtggtgctggggccggaggagctctggccagccaagctcaggcctgaggttctcagacca
gaggtacccaggccaggggacattggttctggaggattcactgatgtctgtcctcgggac
agagccaagggaaatgccgatctggcctatgtcctgaacgcagacccctgcggccactgc
ctgatcatcaacaacgtgaacttctgccgtgagtcggggctcatgacccgcacgggctcc
aacatcgactgtgagaggatgcagcggcgcttccacctgctgcagttggcggtggaggtg
agatgtgacctgacggccaagcaaatggtccaggctttgacgcagctggcgcggcgggac
cacggcgctctggactgctgcgtggtggtcatcctctctcacggctgtcaggccagccac
cgccagttcccaggggctgtttatggcacagacggatgtcctgtgtccgttgagagaatt
gtgaacactttcaatggtactggctgccccagcttgggagggaagcccaagctcttcttc
atccaagcctgtggtggagagcagaaagaccatgggtttgaggtggcctccacttcccct
gaagatgagacccccaatagcaaccctgagacggatgctaccccattccaggaaggccca
cgttccactgacgagccagatgccgtgtctagtctgcccacgcccagcgacatcttggtg
tcctactccaccttcccaggctttgtctcctggagggatcccaagagcggctcctggtac
atcgagaccctggacagcatttttgagcagtgggctcactgtgaggaccttcagaccctc
ctcctcagggtcgctaatgctgtttcagtgaaaggaatttacaaacagatccctggctgt
tttaatttcctccggaaaaaacttttctttaaaacataa

DBGET integrated database retrieval system