KEGG   Ovis aries (sheep): 101111287
Entry
101111287         CDS       T03117                                 

Gene name
SPINT1
Definition
(RefSeq) kunitz-type protease inhibitor 1 isoform X2
  KO
K15619  Kunitz-type protease inhibitor 1
Organism
oas  Ovis aries (sheep)
Pathway
oas05202  Transcriptional misregulation in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101111287 (SPINT1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101111287 (SPINT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:oas01002]
    101111287 (SPINT1)
Peptidases and inhibitors [BR:oas01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   101111287 (SPINT1)
SSDB
Motif
Pfam: Kunitz_BPTI MANEC Ldl_recept_a Chordopox_A13L
Other DBs
NCBI-GeneID: 101111287
NCBI-ProteinID: XP_004010504
Ensembl: ENSOARG00000020293
UniProt: A0A6P3EFX2
LinkDB
Position
7
AA seq 525 aa
MAGGRLSRARIPAVAGWLLCALALRGAEAGPPPVTPGLLTADGCLNRFTPGVPDFVLDTD
ASVRNGATFLRSLTARRGRDCVHACCSSNDCNLALVELQPDGGEDAIVSCFLINCLYEQN
FVCKFAPREGFINYLTREVYRSYRELRTQGFRGSRIPKAWDGTDLKVQPQEPLVLKDVET
TDWRLLRGDTDIRVERSGPDQVELWGLKEGSYLFQLTAAGSDQPESTSNVTVTVLSPEQT
EEYCLVPRKVGRCRGSFPRWYYDPTERICKSFVYGGCLGNKNNYLREEECKLACHNVQGP
SAERHHPVCSGSCHSSKFRCGDGCCIDSFLECDDTPDCPDASDEATCEKYTRDFDKLQRI
HFPRDKGHCVDLPDTGLCSESIPRWYYNPFTEHCARFTYGGCYGNKNNFEEEEQCLESCR
GISKKDVFGLRRESPVVPSTGSVEVAIAVLLGTCIVVVVAILGYCFFKNQKKDFHRHRHP
PPSTPTSSKVSTTDDMEHLVYTKQLDPSEPGPLQGSRHLSPGPAS
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggccgggggccgcctctcccgggcccgcatcccagcggtcgccgggtggcttctctgc
gcgctcgccctccggggcgccgaggccgggccgccgccggtgacccccggtctgctcacg
gccgacggctgcctgaaccgctttacccccggggtgcctgatttcgtgctcgacacggac
gcctcggtcagaaacggggccaccttcctgcgctccctcaccgcgcgccgcggccgggac
tgcgtgcacgcctgctgcagctccaacgactgcaatctggcgctggtggaattgcagccc
gacggcggggaggacgccatcgtctcctgcttcctcatcaactgcctctacgagcagaac
ttcgtgtgcaagttcgcgcccagggagggtttcatcaactacctcacgcgggaggtttac
cgctcctaccgcgagctgcggacccagggctttagagggtcccggatccccaaggcctgg
gacggtacagacttgaaggtacagccccaggagcccctagtgctgaaggatgtggagacc
acagactggcgtctgctgcggggggacacagacatcagggtcgagaggagtggtccagac
caggtggagctgtggggactcaaagaaggcagctacctgttccagctgacggcggccggt
tcagaccagccagagagcacgtccaatgtcacggtcactgtgctgtcccctgagcagacg
gaagaatactgccttgtacccaggaaggtgggccgctgtcgtggttccttcccccgctgg
tactacgaccccacagaacggatctgcaagagtttcgtttatggaggttgcctgggcaac
aagaacaactaccttcgggaagaagagtgcaagcttgcctgccataatgtgcaaggtccc
tcagcagaaaggcatcatccagtgtgttctggcagctgccactccagcaagttccgctgc
ggtgatggctgctgcatcgacagcttcctagagtgtgacgacactcccgactgccctgac
gcctccgatgaggccacctgtgagaaatacaccagagacttcgataaactccagaggatc
catttccccagggacaaagggcactgcgtagacctgccagacacgggcctctgctcagag
agcatcccccgctggtactacaaccccttcactgaacactgcgcccgctttacctatggc
ggttgttatggcaacaagaacaactttgaggaggaggagcagtgccttgagtcctgtcgt
ggcatttccaagaaggatgtgtttggtctgcggcgggaaagccccgttgttcccagcaca
ggctccgtggaggtggccattgcagtgctcctgggtacctgcatcgtggtggtagtcgcc
attctgggctactgcttcttcaagaaccagaaaaaggacttccacagacaccgccacccc
ccaccttccacccccaccagctccaaggtctccaccactgatgacatggaacacctggtc
tataccaaacaactagacccctctgagcctgggcctctccagggctctcgccatctctca
cctggccctgcttcctag

DBGET integrated database retrieval system