KEGG   Ovis aries (sheep): 101111690Help
Entry
101111690         CDS       T03117                                 

Gene name
GNRH1
Definition
(RefSeq) progonadoliberin-1
  KO
K05252  gonadotropin-releasing hormone
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
oas04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101111690 (GNRH1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101111690 (GNRH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GnRH
Motif
Other DBs
NCBI-GeneID: 101111690
NCBI-ProteinID: XP_014948575
Ensembl: ENSOARG00000009889
LinkDB All DBs
Position
2
AA seq 92 aa AA seqDB search
MELTPKLLAGLILLTFCVVGCSGQHWSYGLRPGGKRNAENVIDSFQEIAKEVDQPVEPKC
CGCIVHQSHSPLRDLKEALESLIEEETGQRKI
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atggagctgactcccaaacttctagctggactaatcctgctgactttctgtgtggtgggt
tgctctggtcaacactggtcctatgggctgcgccctggaggaaagagaaatgctgagaat
gtgattgattctttccaagagatagccaaagaggtcgatcagccagtagaacctaagtgc
tgtgggtgcattgttcaccagtcccattctcctctgagggacctgaaagaagctctggaa
agtctgattgaagaggaaactgggcagaggaaaatataa

KEGG   Ovis aries (sheep): 101112753Help
Entry
101112753         CDS       T03117                                 

Gene name
GNRH2
Definition
(RefSeq) LOW QUALITY PROTEIN: progonadoliberin-2
  KO
K05252  gonadotropin-releasing hormone
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
oas04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101112753 (GNRH2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101112753 (GNRH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1180
Motif
Other DBs
NCBI-GeneID: 101112753
NCBI-ProteinID: XP_027832672
LinkDB All DBs
Position
13
AA seq 122 aa AA seqDB search
MASFGLGLLLLLLLLLTTHPGPSKAQHWSHSXYPGGKRASSLPRDPQHPPRPPAQSPGQI
AHTLPSDALAWPEDSVPWKSRTMTRWFLRGKQHLVQTLLVSKVEGPHPWPLQGQLRTEVV
GG
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggccagctttgggctaggccttctgcttctgctgctgctgctgctgaccacccaccct
ggaccctcaaaggctcagcactggtcccacagctgataccctggaggaaaacgagcctcc
agcttaccccgggaccctcagcatcctcctaggcccccagctcaaagcccaggccaaatt
gcccataccctcccaagtgatgctctggcttggcctgaggacagtgtgccctggaagagc
aggaccatgacccggtggttcctccgtgggaagcagcacctggtgcagacactgctggta
agtaaagtggaaggcccccacccttggccactacagggccagctaagaactgaggtggtc
gggggatga

DBGET integrated database retrieval system