KEGG   Ovis aries (sheep): 101112405Help
Entry
101112405         CDS       T03117                                 

Definition
(RefSeq) peptide YY
  KO
K05233  peptide YY
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101112405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_3
Motif
Other DBs
NCBI-GeneID: 101112405
NCBI-ProteinID: XP_027831244
LinkDB All DBs
Position
11
AA seq 118 aa AA seqDB search
MAASASRFRVDTRTDSSAPLQMMAGRRSRPAMATVLLALLVCLGELVDAYPAKPQAPGEH
ASPDELNRYYTSLRHYLNLVTRQRFGKRDSSEALLSVLLFPDREDPPVKSRPEGAYLW
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcagcttcccgcttccgagtagatactcggactgactctagtgcccctctg
cagatgatggcggggcgcagatcgcggcctgcgatggccacagtgctgctggccctgctc
gtctgcctgggggagctggtcgacgcctaccccgccaaaccccaagctccgggagagcac
gcctcgccagatgagctgaaccgctactacacctcgctgcgccactacctcaacctggtc
actcggcaacggtttgggaaacgagactcctcagaagctcttctgtctgtactgctcttt
ccagatcgcgaggacccgccggtcaagtcgcggccagaaggagcctacctgtggtga

KEGG   Ovis aries (sheep): 101114885Help
Entry
101114885         CDS       T03117                                 

Gene name
PYY
Definition
(RefSeq) peptide YY
  KO
K05233  peptide YY
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101114885 (PYY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 101114885
NCBI-ProteinID: XP_027831243
LinkDB All DBs
Position
11
AA seq 117 aa AA seqDB search
MKRTELRRLQPHLQQSSPSDSSGLPSPDHPASGAVAMMAGRRSWPAMAIVLLALLVCLGE
LVDADSKPQPSGEKASWEKHHFSLSHYAKLANRLVDPKLLGSFLSKRISDHANRPVK
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcactgagctgaggaggctgcagccccacctgcagcagtccagcccttcggac
tcctctggccttccatctcctgaccaccctgcctctggagctgtcgctatgatggcgggg
cgcagatcgtggcccgccatggccatagtgctgctggccctgcttgtctgcctgggggag
ctggtcgacgccgactccaaaccccagccttcaggtgaaaaagcctcatgggaaaagcac
cacttctcgctgagccactatgccaagctggccaatcgacttgtggatcctaaactctta
ggatctttcctctccaaacggatcagtgatcatgcgaatcgcccagtcaagtag

KEGG   Ovis aries (sheep): 443280Help
Entry
443280            CDS       T03117                                 

Gene name
PPY
Definition
(RefSeq) pancreatic prohormone
  KO
K05234  pancreatic polypeptide
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443280 (PPY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_3
Motif
Other DBs
NCBI-GeneID: 443280
NCBI-ProteinID: XP_027831245
LinkDB All DBs
Position
11
AA seq 95 aa AA seqDB search
MAAAHRCLFLLLLSTCVALLLQPPLGALGASLEPEYPGDNATPEQMAQYAAELRRYINML
TRPRYGKRDKEGTLDFLECGSPHSAVPREISTMDS
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgcgcaccgctgcctcttcctgctccttctgtccacgtgcgtggctctgttg
ctgcagccacccctgggtgccctgggagcctcgctggagccagagtatccgggggacaat
gccacgccagagcaaatggcccagtatgcggctgagctccgcagatacatcaacatgctg
accaggcccaggtatgggaaaagagacaaagaaggcacactggacttcttggagtgtggg
tctccccactcagcggtccccagggagatcagtacaatggactcataa

KEGG   Ovis aries (sheep): 443508Help
Entry
443508            CDS       T03117                                 

Gene name
NPY
Definition
(RefSeq) pro-neuropeptide Y precursor
  KO
K05232  neuropeptide Y
Organism
oas  Ovis aries (sheep)
Pathway
oas04024  cAMP signaling pathway
oas04080  Neuroactive ligand-receptor interaction
oas04920  Adipocytokine signaling pathway
oas04923  Regulation of lipolysis in adipocytes
oas05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    443508 (NPY)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    443508 (NPY)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    443508 (NPY)
   04920 Adipocytokine signaling pathway
    443508 (NPY)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    443508 (NPY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_3
Motif
Other DBs
NCBI-GeneID: 443508
NCBI-ProteinID: NP_001009452
Ensembl: ENSOARG00000010915
UniProt: P14765
LinkDB All DBs
Position
4
AA seq 97 aa AA seqDB search
MLGSKRLGLSGLTLALSLLVCLGALAEAYPSKPDNPGDDAPAEDLARYYSALRHYINLIT
RQRYGKRSSPETLISDLLMRESTGNIPRTRLEDPSMW
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgctgggtagcaagcgactggggttgtccggactgaccctcgccctgtccctgctcgtg
tgcctgggcgccctggccgaggcgtacccctccaagcctgacaaccctggcgacgacgct
ccggcggaggacttggccagatactactcagcgctgcgacactacatcaatctcatcacc
aggcagagatacgggaaacgatctagccccgagaccctgatttcagacctcttgatgaga
gaaagcacgggaaacattcccagaactaggctggaagacccttctatgtggtga

DBGET integrated database retrieval system