KEGG   Ovis aries (sheep): 101112559Help
Entry
101112559         CDS       T03117                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
oas  Ovis aries (sheep)
Pathway
oas04080  Neuroactive ligand-receptor interaction
oas04972  Pancreatic secretion
oas04974  Protein digestion and absorption
oas05164  Influenza A
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101112559
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    101112559
   04974 Protein digestion and absorption
    101112559
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    101112559
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:oas01002]
    101112559
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    101112559
Enzymes [BR:oas01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     101112559
Peptidases [BR:oas01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101112559
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101112559
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986
Motif
Other DBs
NCBI-GeneID: 101112559
NCBI-ProteinID: XP_012032665
Ensembl: ENSOARG00000016555
LinkDB All DBs
Position
4
AA seq 234 aa AA seqDB search
MAFPSDDDDKIVGGYTCAENSVPYQVSLNAGYHFCGGSLISDQWVVSAAHCYQYRIQVRL
GEHNIDVVEGGEQFIDASKIIRHPKYSSWTLDNDILLIKLSTPAVINARVSTLALPSACA
PAGTECLISGWGNTLSSGVNYPDLLQCLEAPLLSHADCEASYPGQITNNMICAGFLEGGK
DSCQGDSGGPVACNGELQGIVSWGYGCAQKGKPGVYTKVCNYVDWIQETIAANS
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atggctttcccctcggacgacgatgacaagatcgtcgggggctacacctgcgcggagaat
tccgtcccttaccaggtgtccctgaatgctggctaccacttctgcgggggctccctcatc
agtgaccagtgggtggtgtccgcggctcactgctaccaataccgcatccaggtgaggctg
ggagaacacaacattgacgtcgtggagggtggtgagcagttcatcgacgcgtccaagatc
atccgccaccccaagtacagcagctggaccctggacaatgacatcctgctgatcaaactc
tccacgcctgcggtcatcaatgcccgggtgtccaccttggctctgcccagtgcctgtgct
cccgcgggcaccgagtgcctcatctccggctggggcaacaccctgagcagtggcgtcaac
tacccggacctgctgcaatgcctggaggccccgctgctgagtcacgccgactgtgaagcc
tcataccctggacagatcactaacaacatgatctgtgctggcttcctggagggaggcaag
gattcctgccagggtgactctggcggccctgtggcttgcaacggagagctccagggcatt
gtgtcctggggctatggctgtgcccagaagggcaagcctggggtctacaccaaggtctgc
aactacgtggactggattcaggagaccatcgctgccaacagctaa

DBGET integrated database retrieval system