KEGG   Ovis aries (sheep): 101112841Help
Entry
101112841         CDS       T03117                                 

Gene name
CKM
Definition
(RefSeq) creatine kinase M-type
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
oas  Ovis aries (sheep)
Pathway
oas00330  Arginine and proline metabolism
oas01100  Metabolic pathways
Module
oas_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101112841 (CKM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:oas04147]
    101112841 (CKM)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     101112841 (CKM)
Exosome [BR:oas04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   101112841 (CKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN
Motif
Other DBs
NCBI-GeneID: 101112841
NCBI-ProteinID: XP_004015366
Ensembl: ENSOARG00000009785
UniProt: W5PJ69
LinkDB All DBs
Position
14
AA seq 381 aa AA seqDB search
MPFGNTHNKHKLNFKAEEEYPDLSKHNNHMAKALTLEIYKKLRDKETPSGFTLDDVIQTG
VDNPGHPFIMTVGCVAGDEESYTVFKDLFDPIIQDRHGGFKPTDKHKTDLNHENLKGGDD
LDPHYVLSSRVRTGRSIKGYALPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMT
EQEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISM
EKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNEHLGYVLTCPSNLGTGLRGGVHVKLA
HLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLM
VEMEKKLEKGQSIDDMIPAQK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgccgttcggtaacacccacaacaagcacaagctgaacttcaaggctgaggaggaatac
ccagacctcagcaagcacaacaaccacatggccaaggcgctgaccctcgagatttacaag
aagctgcgggacaaggagacgccatctggcttcactctggatgatgtcatccagacaggt
gtggacaacccaggtcaccccttcatcatgaccgtgggctgtgtggctggtgatgaggag
tcctatacggttttcaaggacctctttgaccccatcatccaggaccggcacgggggcttc
aaacccaccgacaagcacaagactgatctcaaccatgagaacctcaagggtggagacgat
ctggacccccactacgtgctcagcagccgtgtccgcacgggccgcagcatcaagggctat
gcactgccccctcactgctcccgcggcgagcgccgggccgtggagaaactctccgtggaa
gccctcaacagcctgacgggcgagttcaaggggaaatactaccctctgaagagcatgacg
gagcaggagcagcagcagctcatcgacgaccacttcctgttcgacaagcccgtgtccccg
ctgctgctggcttcgggaatggcccgagactggcctgatgcccgcggtatctggcacaat
gacaacaagagcttcctggtgtgggtgaacgaggaggaccacctccgagtcatctccatg
gagaaggggggcaacatgaaggaggttttccgccgcttctgcgtggggctgcagaagatt
gaggagatattcaagaaggccggccacccgttcatgtggaacgagcacctgggctacgtg
ctcacctgcccatctaacctgggcaccgggctgcggggaggcgtgcatgtcaagttggcg
cacttgagcaagcatcccaagttcgaggagatcctcactcgcctgcgcctgcagaagcga
ggcacaggtggtgtggacacggctgccgtgggctcagtgttcgacgtgtccaacgccgac
cggctgggctcgtccgaggtagaacaggtgcagctggtggtggatggtgtgaagctcatg
gtggagatggagaagaagctggagaagggccagtccatcgacgacatgatccccgcccag
aagtag

DBGET integrated database retrieval system