KEGG   Ovis aries (sheep): 101113199
Entry
101113199         CDS       T03117                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
oas  Ovis aries (sheep)
Pathway
oas05200  Pathways in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101113199 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101113199 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101113199 (NKX3-1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    101113199 (NKX3-1)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN Homez
Other DBs
NCBI-GeneID: 101113199
NCBI-ProteinID: XP_004004232
Ensembl: ENSOARG00000010071
UniProt: W5PK28 A0A6P3E140
LinkDB
Position
2
AA seq 246 aa
MLRTPEPRPGNAGAVGCSPHAVPPTQTKPLTSFFIQDILWDGADRRGGHAGSPQPQPSRQ
PSRLYPRRDPKPEPERGRGGARAPEDQQSDQPRAGSEEAEKPAETEPDGHLETYLLDCEN
PPSALQSLPPATKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQV
KIWFQNRRYKTKRKQLTSDLGTLEKHSSLPALKEEGFSQGSLISVHNTYPYYPYIYCLGG
WSPAFW
NT seq 741 nt   +upstreamnt  +downstreamnt
atgctccggactccggagccacggcccgggaacgcgggggccgtaggctgcagtccccat
gctgtgccgcccacccagaccaagccgctcacctccttcttcatccaggacatcctttgg
gacggcgctgaccggcgcggaggtcacgcgggcagtccacagccgcagccttcgcgtcag
ccttctcgcctctacccgaggcgagacccgaagccggagcccgagcgaggaagaggcggc
gcccgggcgccggaggaccagcagagcgaccagccccgcgccgggagcgaggaggccgag
aaaccggcggagaccgagccagatgggcacttagagacttatctgctggactgtgaaaac
cctcccagcgccttacagagcctacccccagccaccaaacagcctcagaagcgctcccgg
gctgccttctctcacactcaggtcattgagttggagaggaaattcagccatcagaagtat
ctgtcggcccccgaaagggctcacctggccaagaacctcaagctcacagagacccaagtg
aaaatatggttccagaacagacgctataagaccaagcggaagcagctcacctcggacctg
ggcaccctggagaagcactcttccttgccagctctcaaagaggagggcttctcacagggc
tccctcatctccgtgcacaatacctacccttactacccctacatttactgcctgggtggc
tggagcccagctttctggtaa

DBGET integrated database retrieval system