KEGG   Ovis aries (sheep): 101113407Help
Entry
101113407         CDS       T03117                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
oas  Ovis aries (sheep)
Pathway
oas00052  Galactose metabolism
oas00500  Starch and sucrose metabolism
oas01100  Metabolic pathways
oas04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101113407 (MGAM)
   00500 Starch and sucrose metabolism
    101113407 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101113407 (MGAM)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101113407 (MGAM)
    3.2.1.20  alpha-glucosidase
     101113407 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101113407
NCBI-ProteinID: XP_004008356
Ensembl: ENSOARG00000014509
LinkDB All DBs
Position
4
AA seq 1832 aa AA seqDB search
MARKKLKKFTTLELMLSILLLVVFIITIPIFVLSARDSLESQDPGTTVSPDPGTSTTPGS
AECPVVNDSERINCIPDQSPTKATCDQRGCCWSPQGTISKPWCYYSKNHGYRVGGDLMNT
NAGFTAQLERLSSPSLFGNNVNNVLLTAEYQTSNRFHFKLTDQNQNRYEVPHEHVQPFTG
NAASSLTYKVEVSKQPFGIKVIRTSNNRVLFDSSVGPLLFAHQFLQLSIRLPSANVYGLG
EHVHQQYRHDMNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLLNSNAM
EVFLQPTPAITYRTIGGILDFYVFLGSTPEQVVQEYLELIGRPALPSYWALGFHLSRYDY
GTLENMKEVVERNRAAQLPYDVQHADIDYMDARKDFTYDPVAFKGFPEFVKELHNNGQKL
VIIVDPAISNNSSLSNPYGPYDRGSDMKIWVNTSDGVTPLIGEVWPGKTVFPDYTNPKCT
AWWTNEFELFHSQVEFDGIWIDMNEVANFVDGSVSGCSTSNLNYPPFTPKILDGYLFSKS
ICMDAVQHWGQQYDVHNLYGYSMAIATSETVKTVFPNKRSLILTRSTFAGSGKFAAHWLG
DNAATWNDLRWSIPGILEFNLFGIPMVGADICGFILDTSEELCRRWMQLGAFYPFSRNHN
GQGYKAQDPASFGADSLLLNSSRHYLTVRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYQ
DSNTWDVHQQFLWGPGLLITPVLDEGAEKVTAYMPDAVWYDYETGVQERWRKQKVEMELP
GDKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIALDENKEAKGELFWDDGETKDTVAN
NLYLLCEFSVTQNRLEVKILQSTYTDPNNLAFKEIKILGTQELKNVAVKQNGVPVQVSPN
VTYDSNLQVALITGIDLVLGGTYTVEWDVKIRDEEKIDCYPDQTGVSAENCTARGCVWEE
SSSRVVPFCYFVSDLYSVSDVQYDSHGASAVISLKTSQYAHSFPSVPVNSLRLTVTYHKD
YMLQFKIYDPSNNRYEVPVPLNIPNVPSGTPESQLYAVLIKENPFGIEIRRKSTGTVIWD
SQLLGFTFNDMFIRISTRLPSRYLYGFGETEHTAFRRDLGWNTWGMFSRDQPPGYKKNCY
GVHPYYMAMEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVVLGPTPELVTQ
QYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDAMVAAQIPYDVQYSDIDYMERQL
DFTLDVEFEGFPALITRMKADGMRVIIILDPAISGNETKPYLPFTRGVEDDVFIKDPSDG
SIVWGKVWPDFPDVVINSSLDWDSQVEKYRAFVAFPDFFRNSTIAWWKRELKELYTNPRE
PEKSLKFDGLWIDMNEPASFVNGAVLPGCKNATLNNPPYMPHLESRDLGLSSKTLCMESQ
QVLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDN
TAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFARNHNTI
GTRRQDPVSWNSTFVTISKSVLETRYTLLPYFYTLMHKASTEGSTVVRPLLHEFVSDRVT
WTIDSQFLLGPAFLVSPVLEANARDVTAYFPKARWYDYYTGVDIQSMGEWKSLPAPLDHI
NLHVRGGYVLPWQEPAQNTHLSRQKFFGFKVALDDEGTAEGWLFWDDGQSIDTYEKGQYY
LAHFSVSQNTMQSHIIFNKYISDTNPLRLGYFEVWGVGSDSISSVSISVSGVVITPTFSY
NSTTQVLNIDVTSRNISLHNFTSLTWRSTLNF
NT seq 5499 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaagttcactactttggagcttatgctcagtattcttctg
cttgtggtgtttatcatcactattcccatcttcgtgctttcagccagagattccctggaa
tcacaagatcctgggacgacagttagcccagatcctgggacaagtaccacccctggttct
gctgagtgcccagtggtaaatgactcggaacggataaactgcatccctgaccaatcacca
acaaaggctacctgtgaccagcgtggctgttgctggagtcctcagggaaccataagtaag
ccctggtgctactattctaagaatcatggctatcgagtagggggcgacctcatgaacaca
aatgcaggattcacagcccagctggaaaggttgtcttctccatctctgtttggaaataat
gtcaacaatgtccttctcacagcagaataccagacatctaaccgtttccactttaagtta
actgaccaaaaccagaacagatatgaagtaccccatgaacacgtgcaacccttcacagga
aatgctgcctcttccttgacatataaagttgaggtctccaaacagccgtttggcatcaaa
gtgatcagaacgagcaacaatcgtgttctgtttgactccagcgttgggcccctgctgttt
gctcaccagttcctgcagctgtccatccgactgcctagtgccaacgtgtatgggctggga
gaacacgtgcaccagcagtaccggcatgacatgaactggaagacctggcccatatttgcc
agggacaccacccccaatggggatggaactaacttgtatggtgcacagacattcttccta
tgccttgaagatgctagtggattgtcctttggagtgtttctgctgaacagcaatgccatg
gaggttttcctccagcccaccccagctatcacttaccgcaccatcgggggcattctcgac
ttttacgtgttcttggggagtactccagagcaagttgttcaagaatacttagagctcatt
ggacggccagccctaccctcatactgggcgcttgggtttcatctcagtcgttatgactat
ggaaccctagagaacatgaaagaagtcgtggagagaaaccgtgctgcgcagctgccttat
gatgttcagcacgctgatattgattacatggatgcaagaaaggacttcacttatgatcca
gtagctttcaagggcttccctgagtttgttaaagaattacacaataatggacagaaactg
gtcatcattgtggatcctgccatctccaacaactcttccctaagtaatccctatggcccg
tacgacaggggttcagatatgaagatatgggtgaatacttcagatggagtgactccactc
attggggaggtctggcctggaaaaactgtgtttcctgattacaccaaccctaagtgtact
gcttggtggacaaatgaatttgagcttttccacagtcaagtagagtttgatggaatctgg
attgatatgaatgaagtcgccaacttcgtggatggctcagtttcaggatgttccacgagc
aatctaaattatcccccattcactcccaaaatcctggatgggtacctgttcagcaagagc
atctgcatggacgcagtgcagcactgggggcaacagtacgacgtccacaacctgtacggc
tactccatggccatcgccacctcagaaactgtcaagactgtgttccccaacaagagaagc
ctcattttaacccgttctacatttgcgggttctggcaagtttgcagcccactggttggga
gacaatgcagccacctggaacgacctccgatggtccatccctggcatacttgagttcaac
ctttttggtatcccaatggtgggtgctgacatatgtggctttatactggacacttctgaa
gagctctgcagacggtggatgcagctgggagcattctatccattttccaggaatcacaat
ggccaaggctacaaggcccaggatccagcctcctttggcgccgactcgctgctgttgaat
tcctccaggcactacctgaccgtccgctatacccttctgccctatctctacaccctcttc
taccgtgctcacagccgcggagacaccgtggccaggccccttctgcatgagttctaccag
gacagcaacacctgggatgtgcaccagcagtttttatgggggcccggcctcctcatcact
ccagtcctggatgagggtgcagagaaagtgaccgcatacatgcctgacgctgtctggtat
gactatgagactggggtccaagagagatggaggaagcaaaaagtggagatggaacttcct
ggagacaaaattggacttcacctgcgaggaggctacatcttccccacgcagcagccagcc
acgaccacagtggccagtcggcggaaccctcttggtctaatcattgccctggatgagaac
aaagaagcaaaaggcgaacttttctgggatgatggggaaacaaaagatactgtggccaac
aacctttatctcttatgtgagttctccgtcacccaaaaccgactggaggttaagattttg
cagtcaacctacacagaccccaataatttagcatttaaagaaattaaaatccttggaacc
caggagcttaagaacgttgcagtgaaacagaacggtgttccagttcaagtttctcctaat
gtcacttacgattctaacctacaggtggcccttatcacaggaattgatcttgttctggga
ggaacatacacggtggagtgggatgtgaagatacgagatgaagaaaaaatagactgttat
cctgatcagactggtgtttctgcagaaaattgcactgcccgcggttgtgtctgggaggaa
tccagttctcgtgtagtccctttttgctatttcgtcagtgacctctactctgtcagtgat
gttcagtatgactcacacggggcctcagctgtcatctccttaaagacttctcagtatgcc
cactccttcccctcagtacctgtgaactccctccgcctgactgtgacctaccataaggat
tacatgctgcagtttaagatttacgatcccagcaacaaccgctatgaagttccagtccct
ctcaacatacccaacgttccatctggcacccctgagagtcaactctatgctgtcctcatc
aaggagaatccatttgggattgaaattcgccgcaagagtacaggcactgtcatctgggac
tctcagctcctcggcttcaccttcaatgacatgttcatccgcatctccacgcgcctccct
tcccggtacctctacggcttcggggaaactgagcacacagccttccgaagagacttggga
tggaacacgtgggggatgttctcccgagaccaacccccggggtacaagaagaactgctac
ggtgtccacccctactacatggcaatggaggaggatggcagtgcccatggagtgctcctg
ctgaacagcaatgccatggatgtgaccttccagcccttgcctgccttgacataccgaacc
acaggaggaattctggacttttatgtggttttagggccaactccagagcttgtcactcag
cagtacactgagttgattggtcggccagtgatggttccttactggtccctggggtttcag
ctgtgtcgctatggataccagaacgactctgagatcgccagcttgtacgatgcgatggtg
gccgcacagatcccctatgatgtgcagtactcggacattgactacatggagcggcagctg
gacttcacccttgacgtcgagtttgaggggtttccagctctgattactcgcatgaaggcc
gatgggatgcgagtcattatcattctggacccagccatttctggcaacgagaccaagccc
tatctgccattcacacggggtgtagaggatgatgtcttcatcaaagatccgagtgatggg
agcattgtctggggaaaggtctggcctgattttcctgatgtggtaataaacagttctcta
gactgggacagtcaagtggagaaataccgggcatttgtggcctttccagactttttccgt
aattcaaccatcgcatggtggaagagggagttgaaagaactgtacaccaatccacgggag
ccagagaagagcttgaagttcgatggcttgtggattgatatgaacgaaccagcgagcttc
gtgaatggagcagtccttccaggctgcaagaatgccactctgaacaaccctccctatatg
ccacatctggagtccagggacctgggcctgagcagcaagaccctgtgcatggagagccag
caggtcctgcctgacggctcaccggtgcgccactacgacgtgcacagcctctacgggtgg
gcccagaccagacccacatacgaagctgtgcaggaggtgacgggacagcgagggatcgtc
atcactcgctccacgttcccctcttctggccgctggggaggacactggctgggagacaac
acggccgcgtgggaccagctgaagaagtcaatcattggcatgatggagtttagtctcttt
ggtatatcctacacaggagcagatatttgtggattctttcaagatgctgaatatgaaatg
tgtgctcgctggatgcaactaggggccttctaccccttcgcaaggaatcacaataccatt
gggaccaggaggcaagaccccgtgtcctggaattctaccttcgtgacaatctccaagagt
gtcctggagaccagatacaccctgttgccgtatttctacaccctgatgcacaaggccagc
acagagggcagcaccgtcgtgcggcctctccttcatgagtttgtgtcagaccgggtgacc
tggactatagacagtcagttcctgctgggcccagccttcctggtcagccctgtcctggag
gctaacgctagagatgtcactgcatatttccctaaagcccgctggtatgattactatacg
ggtgtggacatccaatcgatgggtgagtggaagtccttgccagcgcctcttgaccacatt
aatcttcatgtccgtgggggctacgtcctgccctggcaagagcctgcacagaacacccac
ttaagccgtcagaaattcttcggtttcaaggtcgccttggatgatgaggggactgctgaa
ggctggctcttctgggatgatgggcaaagcattgatacctatgaaaaaggacaatattac
ctggcccacttttcagtcagccagaataccatgcagagtcatataattttcaacaaatac
atcagtgatacaaaccctttgagactgggctactttgaggtctggggagtgggcagtgac
tccatctccagtgtcagcatctctgtgagtggcgtggttataacacccaccttctcctac
aactctacaacacaggtgttaaatattgatgtgaccagcagaaacatcagcctacataat
ttcacttcattgacatggagaagcacactgaatttttag

DBGET integrated database retrieval system