KEGG   Ovis aries (sheep): 101113631
Entry
101113631         CDS       T03117                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
oas  Ovis aries (sheep)
Pathway
oas04022  cGMP-PKG signaling pathway
oas04141  Protein processing in endoplasmic reticulum
oas04151  PI3K-Akt signaling pathway
oas04211  Longevity regulating pathway
oas04261  Adrenergic signaling in cardiomyocytes
oas04668  TNF signaling pathway
oas04728  Dopaminergic synapse
oas04911  Insulin secretion
oas04915  Estrogen signaling pathway
oas04918  Thyroid hormone synthesis
oas04925  Aldosterone synthesis and secretion
oas04926  Relaxin signaling pathway
oas04927  Cortisol synthesis and secretion
oas04928  Parathyroid hormone synthesis, secretion and action
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas05020  Prion disease
oas05030  Cocaine addiction
oas05031  Amphetamine addiction
oas05034  Alcoholism
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101113631 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101113631 (ATF6B)
   04022 cGMP-PKG signaling pathway
    101113631 (ATF6B)
   04151 PI3K-Akt signaling pathway
    101113631 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101113631 (ATF6B)
   04915 Estrogen signaling pathway
    101113631 (ATF6B)
   04926 Relaxin signaling pathway
    101113631 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    101113631 (ATF6B)
   04918 Thyroid hormone synthesis
    101113631 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    101113631 (ATF6B)
   04925 Aldosterone synthesis and secretion
    101113631 (ATF6B)
   04927 Cortisol synthesis and secretion
    101113631 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101113631 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101113631 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    101113631 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101113631 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    101113631 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    101113631 (ATF6B)
   05031 Amphetamine addiction
    101113631 (ATF6B)
   05034 Alcoholism
    101113631 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101113631 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101113631 (ATF6B)
   05161 Hepatitis B
    101113631 (ATF6B)
   05163 Human cytomegalovirus infection
    101113631 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101113631 (ATF6B)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101113631 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB bZIP_Maf DUF4407 GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 101113631
NCBI-ProteinID: XP_004018972
Ensembl: ENSOARG00000000927
UniProt: W5NS24
LinkDB
Position
20
AA seq 707 aa
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYAGLDEVAEEQTQLFRCPEQDVPFGSSSL
DLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSFSSESSHLSTEPFSQAPGVREMLV
VKSESLAPPLCLLGDDPTSPFETIQINVSPTSDDPSDVQIKIEPASPSSSISSEAPLLSA
ESPSQAFIGEEVLEVKTESPSPQGCLLQDVASPLPGAVQVSVGLSSDGSSGKALPTRKPP
LQPKPVVITTVPMPLRAVPASTTVLLQPLVQPPPVSPVVLIQGAVRVRPEGPTPPTPRPE
RKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLTENSELKLGSGNRKVVCVMVFLLFIAFNFGPVSISEPPPAS
ISPRMSRGESRPQRHLLEFSAQEPVHGAEPPQHPFQDPEEPQPSPTGRPSFRNLTAFSGD
ARELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKTPQRAQEKQKSQLW
KKSPPVQAVPTRPPGPPEGDSMGQLQLYRQPDRSQPEFLDAIDRREDTFYVVSFRRDHLL
LPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVIHIKTSTVP
PSLRKQPSSTPGNATGGPLPASAAASQAHQAAHQPSTSIISDLYDSH
NT seq 2124 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagattgcggacccgacacgctttttcaccgacaac
ttgctgagcccggaggactgggacagcactttgtacgccggcttggatgaagtggccgag
gagcagacgcagctcttccgttgtccggagcaggatgtcccgtttggcagcagctccctg
gacctggggatggacgtcagccctcctgaacccccctgggactctctgcctatcttccca
gatctccaggtgaagtctgagccatcctccccctgctcttcctcctccttcagctctgaa
tcatcacatctttccacagagcccttcagccaggcccctggtgtaagggagatgctggtt
gtgaagtcagagtccttggcacccccactctgcctcctgggagatgatccaacatcccca
tttgaaaccatccagatcaatgtcagccccacctctgatgatccttcagatgttcagatt
aagatagagcctgcctctccgtcttcctccatcagctcagaggctcccctgctctctgcg
gagtctcccagccaggctttcataggagaggaggtcctggaagtaaaaacagagtccccg
tcccctcagggatgtctcctgcaggatgtcgccagcccccttcctggagctgtccaagtc
agcgtgggcctatcctctgacggctcctcaggcaaagccctgcccacccggaagccacca
ctgcagcccaaacctgtggtgataaccactgtcccgatgccactgagagccgtgcccgcc
agcaccaccgtcctcttgcagccccttgtccagccacccccagtgtccccagtggtcctc
atccaaggtgctgttcgagtccggcctgagggaccgacccctcctactccacggcctgag
aggaagagcattgttccagcccctatgcctgggaactcctgcccacctgaggtggatgcc
aagctgctcaagcggcagcagcggatgatcaagaaccgggagtcggcctgccagtcccgc
aggaagaagaaagagtacctgcaggggctagaagctcggctgcaggccgtcctggccgac
aaccagcagctccggcgggagaatgctgccctccgccggcggctggaggccctgctgact
gagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcgtcatggtcttc
cttctcttcatcgctttcaactttgggcctgtgagcatcagtgagcctcctccggcttcc
atctctcctcggatgagcagaggggagtctcgaccccagagacacttgctggagttctcg
gcacaagagccagttcatggagccgagcccccccagcatcccttccaggaccctgaggag
ccccagcccagccctacaggccgcccaagtttcaggaacctgacagccttctctggggac
gccagggagctgctgctgagagacctggaccagctcttcctctcctcggattgccggcac
ttcaaccgaaccgagtccctgaggcttgctgacgagctgagtggctgggtccagcgccac
cagagaggccggcggaagacaccccagagagcccaggagaaacagaagtctcagctgtgg
aagaagtcacctccagttcaggcagtccccacccgcccccctgggcccccagaaggggat
tccatgggccagctgcagctgtaccgccaaccagaccgttcgcagcccgagttcctggat
gcaattgaccgacgggaagacacattttatgttgtttccttccgaagggatcacttgctg
ctcccagccatcagccacaacaagacctcccggcccaagatgtccctggtgatgcctgcc
atggcccccaatgagaccctgtcaggccgggggccccctggggactatgaggagatgatg
cagatcgagtgtgaggtcatggataccagagtgattcacatcaagacctccacagtgccc
ccctcgctacgaaaacagccgtcctcaaccccgggcaatgccacaggtggccccttgcca
gcttctgcagcagccagccaggcccaccaggccgcccatcagccctctacctcaataatc
tctgacctctatgactcacactga

DBGET integrated database retrieval system