KEGG   Ovis aries (sheep): 101113672Help
Entry
101113672         CDS       T03117                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351 isoform X1
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
oas  Ovis aries (sheep)
Pathway
oas00052  Galactose metabolism
oas00500  Starch and sucrose metabolism
oas01100  Metabolic pathways
oas04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101113672 (MGAM2)
   00500 Starch and sucrose metabolism
    101113672 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101113672 (MGAM2)
Enzymes [BR:oas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101113672 (MGAM2)
    3.2.1.20  alpha-glucosidase
     101113672 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 101113672
NCBI-ProteinID: XP_012032658
Ensembl: ENSOARG00000014980
LinkDB All DBs
Position
4
AA seq 2587 aa AA seqDB search
MARKLSALEILLIIFIIIVLAVDILLLMLLLEKPSGASFVPECPEIPESERIDCAPGQEV
TEDVCRQKYKCCWKPVPDTAIPWCFFPRNWGYEISNRIENTSTGCTARLRRLPSPSLFGY
DVIDTLFTAEHQTSNRFHFKITDFNNMRYEVPHENVKLFDGNADASNLSYHLEVIHKPFG
IKIMRTSNKRVLLDTSIGPLQFAQQYLQLSMRLPSANVYGLGEHVHQQYRHNMTWETWPI
FTRDATPTEGMINLYGAHTFFLCLEDTSGFSFGVFLMNSNAMEVTLQPAPAVTYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRNYGGIDGLKNVVNRTREAEI
PYDVQYSDIDYMDEKKGFTIDGVAFHGLSDFAKELHQNGLKYVIIMNPGILNNSDYQPYV
NGSRKGVWILGNKGFAVGQAYPGWTVFPDFTNSDCTEWWKEQFSEFYKTLEFDGVWIEMD
EVSSFLQSSDQDCEVNNFNFPPFKPRVLDHLLFSRTLCMDTEFREGLHYDVHSLYGYTMA
RATDVAMETIFPKKRHFILSRSTFAGSGKFAAHWLGDNAARWDDLRWSIPGILEFNLFGI
PMVGANICGYTENVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFSENNAMLLESSR
YYLNIRYTLLPYLYTLFYRAHTLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVL
YEGLNYARAYIPDAIWYDYETQVAIEWRKQFVELLLPGDRIGLHLRGGYIFPIQRPNTTT
EASRKNSLGLIIALDSKREANGELYWDDGVSKDAVTENSYILYNFSITSNRLQATIIHAN
YTDPDKLTFTDIMILGMDKEPTNFTVSLNDATTSISNVVYTESTKVVNITDLKGLVLGQA
FSIQWDLPVSDLQKFNCFPEQPAVSEESCRERGCLWEPTTVPGVPTCFYDTIPSYAASNI
QYLPTGITVDLTHLTASEAAEAMVPLPSSRDKLPPPAATAKAASASDTLSATVGFLRLSV
IYHTENMLQFKIYDPTNKRYEVPVPLNTPSSPVGSPENRLYDVKIRNNPFGIQIRRKSSS
TVIWDSQLPGFTFRDMFLSISTRLPSQYLYGFGETEHTTFRRNISWHTWGMFARDEPPAY
KKNSYGVHPYYMALEGDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTP
ELVTQQYTELIGRPAMIPYWALGFQLSRYGYQDDYEISSLYVAMTAAQIPYDVQHVDIDY
MDRKLDFTLSPSFQNLGLLIEQMKKNGTRFVLVLDPAISGNETQYLTFTRGKESDVFIKW
PDNSDIVWGKVLPDLPNVNVDGSLDLETQVKLYKAHVAFPDFLRNNTAAWWKREIEELYR
NPREPEKSLKFDGLWINMNEPSNFVNGSVKGCSNEILNNPPYVPYLEARDQGLSSQTLCM
ESQQVLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWL
GDNTAAWDQLKKSIIGMMECSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNH
NTFGTRRQDPVAWDSAFEMFSRKVLQTRYTLLPYLYTLMHKAHAEGSTVVRPLLHEFTEE
RTTWDIDHQFMLGPAILISPVLENNTFQVQAYFPRARWYDYSTGSGNESTGEWKVLEAPL
DHINVHVRGGYILPWQEPAMNTQSSRQKYMGLIVALDDNGRAEGQLFWDDGQSIDTFENG
NYFLVNFTAAQSVLQIQMIHNNYLSDTNSLKVGYISIWGINSTDITQVTVSYDNQQFMVM
NFKSDPYNQTLNIQLTDKIISLEKLTEVTWIHGGPIVSTTAMASTFPMSSSRPSAASTAA
AASDTTSSSASSGTGTSTAESTSAALPTTTTSFPTSAAEVSAGATVANTSASLPTNTAPE
STSVMLPATTMPYPTSATEVSTSTTVPNTTIHFPINTTTDSTDITLPITTMPYPTSTAEF
STSTTVPNTTIHFPINTTTDSTNVTLPITTMPYPASTAEVSTSTTVPNTTIHFPINTTTD
STNVTLPITTMPYPASTAEVSTSTTVPNTTIHFPINTTTDSTNVTLPITTMPYPASTAEV
STSTTVPNTTIHFPINTTTDSTNVTLPITTMPYPASTAEVSTSTTVPNTTIHFPINTTTD
STDITLPITTMPYPTSTAEFSTSTTVPNTTIHFPINTTTDSTDITLPITTMPYPTSTAEF
STSTTVPNTTIHFPINTTTDSTDITLPITTMPYPASTAEVSTSTTVPNTTIHFPINTTTD
STNVTLPITTMPYPASTAEVSTSTTVPNTTIHFPINTTTDSTNVTLPITTMPYPASTAEV
STSTTVPNTTIHFPINTTTDSTNVTLPITTMPYPASTAEVSTSTTVPNTTIHFPINTTTD
STNVTLPITTMPYPASTAEVSTSTTVPNTTIHFPINTTTDSTNVTLPITTMPYPASTAEV
STSTTVPNTTIHFPINTTTDSTNVTLPITTMPYPASTAEVSTSTTVPNTTIHFPINTTTD
STNVTLPITTMPYPASTAEVSTSTTVPNTTIHFPINTTTDSTNVTLPITTMPYPASTAEV
STSTICP
NT seq 7764 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagcttagtgcattggaaattcttctgatcatcttcatcataattgtactt
gctgtagatatcctcttgctgatgcttctgttggagaagccttcaggcgcttcatttgtt
ccagagtgccccgaaatccctgaatcagaaaggatagactgtgcccctggccaggaggtg
acagaggatgtctgcagacagaaatataagtgctgctggaaacctgtgccagatactgcc
atcccctggtgcttcttccccaggaactggggctacgaaatcagcaatcggattgaaaat
acaagcacagggtgtactgcccggttgagaaggttgccatcaccatctctgtttggatat
gacgtaatcgacaccctcttcacagctgaacatcagacatccaatcgtttccattttaag
atcactgatttcaataacatgcgctatgaagtcccccatgaaaatgttaagctttttgat
gggaatgctgatgcttccaatttgagctatcatctagaagtcattcacaaacccttcggc
atcaaaataatgaggaccagcaacaaaagagtcttgttggacaccagcattgggcccctc
cagtttgcccagcagtacctgcagctctccatgcgactgcccagtgccaacgtgtacggg
ctgggcgaacacgtgcaccagcagtaccgccacaacatgacctgggagacctggcccatc
ttcacccgggacgccacccctaccgagggcatgattaatctatacggagctcacacgttc
ttcttgtgcctagaagacaccagcggcttctctttcggggtttttctgatgaacagtaac
gccatggaggtcacccttcagcccgctcctgccgtcacttaccgcacgatcgggggtatc
cttgacttttacgtgttcctgggaaatactccagaacaagtggttcaggaatacctggag
cttgttggacgaccattcttgcctccctactggagtcttgggttccagcttagtcgcagg
aattatggtggcattgatggattgaaaaatgttgtaaaccgaactcgtgaagctgagatc
ccatatgatgtccagtactctgacatagactacatggatgaaaagaagggtttcactatt
gacggagtggctttccatggcctctcagattttgccaaagagttacatcaaaatggactg
aaatatgtaattattatgaatcctggcatcttaaataactctgactaccagccttatgtg
aatggaagcagaaagggagtgtggatcttggggaacaaaggctttgctgttgggcaggca
tatcctggttggacagtttttcctgattttactaattcagattgtactgagtggtggaaa
gagcagttcagtgaattttataaaactctggagtttgatggagtgtggattgaaatggat
gaagtatctagctttctacaaagttctgatcaagactgtgaagtaaacaacttcaacttt
cctcctttcaaacctcgagttctggaccacttgcttttctcaagaaccctctgcatggac
acagagtttcgtgagggccttcactacgatgtccacagcttgtatggctacaccatggca
agagccacggatgtggccatggagactatcttccccaaaaagagacacttcatcttatca
cgttctacttttgcgggatctggcaaatttgctgctcattggttgggggacaatgcagcc
agatgggacgatctccgatggtccatccctgggatcctggagttcaacctattcggcatc
cccatggtaggtgccaacatctgtggttatacagagaatgtcacagaggagctctgcaga
cggtggatgcagctgggagcattttatccactgtcgaggaatcacaatgggcctgggttc
agggaccaggatcctgctgccttcagtgaaaacaacgctatgctattggaatcctccaga
tactatctgaacatccgctacaccctgctgccctatctctacacccttttctaccgagct
cataccctgggcgagaccgtagcaaggcccctcgtccacgagttctaccaggacccagcc
acctgggaggtgcacgagcagttcctctgggggcctggactcctcatcacgcctgtttta
tatgaaggtttgaactatgcaagagcatacatacccgacgccatctggtatgactatgaa
acgcaagtagccatagaatggaggaaacaatttgtggagctgctgctgccaggtgatagg
ataggacttcacctccgagggggctacatctttcccatccagcggccaaacacgaccaca
gaggccagccggaagaactctctgggactcatcattgccttggactctaagcgagaagca
aacggagagctgtactgggatgatggtgtctctaaagatgctgtaactgaaaatagttat
attctgtataatttttccatcacctctaaccgtctacaggcaacgattatacatgctaat
tatacagaccctgacaaactcacatttacagatatcatgatattgggaatggacaaggaa
cctactaattttactgtctccctaaatgatgctaccacctccatttcaaacgttgtctac
acagaatcaacaaaggtggtgaacatcactgacctcaagggactggtactgggacaagca
ttctccattcagtgggatctgccggtcagtgacctgcagaagttcaactgctttcctgag
cagcccgctgtctccgaggagagttgcagggagcgggggtgcctttgggagcccacgact
gttcctggggtgcccacctgtttctatgacaccatccccagttatgctgccagcaacatt
cagtacctgcctacgggcatcaccgtagatctcacccacctgacagcctcggaagctgca
gaagctatggtgccactaccatcatcacgggacaagctacccccacctgcagccacagcg
aaggccgcctctgcctctgacactctctctgcaaccgtcggctttctccgcctgagtgtg
atctaccacacagagaacatgctgcagttcaagatctatgatcccactaataaaaggtat
gaggtcccagtgcctctgaacaccccttcgtctccagtgggctcccctgaaaaccgtctg
tatgatgtcaagattcggaacaatccttttgggatccaaattcgaagaaaaagctccagc
actgtgatttgggactctcagctccctggattcaccttcagggacatgttcctttccatc
tccacacgccttccctctcagtacctctatggctttggggaaactgagcacacaactttc
agaagaaatataagctggcacacgtgggggatgtttgcccgagatgagccaccagcgtat
aagaagaactcctatggtgtccacccctactatatggcactggagggggatggcagtgcc
catggagtgctcctgctgaacagcaatgccatggatgtgacattccagcctactcctgcc
ctgacatatcgcaccacaggaggcattttggacttttatatggttttggggccaacccct
gagcttgtaactcagcaatacactgagttgattggtcggccagcaatgattccctactgg
gccttgggattccagctgagtcgctatggataccaggatgattatgaaatctccagtttg
tatgttgcaatgacggctgctcagattccctacgatgtccagcatgtagacattgactac
atggaccggaagctggacttcaccctcagccccagctttcaaaatcttggtctcctgatt
gagcaaatgaagaaaaatggcacgagatttgttcttgttctggacccagccatttctggc
aatgagacccagtatctcacatttaccagagggaaggaaagtgatgtgtttatcaaatgg
ccagacaacagcgatattgtctggggaaaggttttgccagatctgcccaatgtgaacgtg
gatgggtcccttgatctcgaaactcaggttaagctgtacaaagcccatgttgcctttcct
gacttcttgcggaacaacacagctgcctggtggaagagggaaatagaagagctctacaga
aaccctcgagagcctgagaagagcttgaagtttgatggattgtggattaacatgaatgaa
ccatcgaactttgtgaatggatctgtcaagggctgcagcaatgaaattcttaataatcca
ccctatgtgccatacttggaggcccgggaccagggcctgagcagccagaccctgtgcatg
gagagccagcaggtgctgcccgatggctcaccggtgcgccactacgacgtgcacagcctt
tatggctgggcccagaccagacccacgtacgaagccgtgcaggaggtgacgggacagcga
gggatcgtcatcactcgctccactttcccctcttctggtcgctggggaggacactggctg
ggcgacaacacggccgcgtgggaccagctgaagaagtcaatcattggcatgatggaatgc
agtctctttggaatctcctatacaggagcagacatctgtggattctttggagatgctgag
tatgagatgtgtgttcgctggatgcagctgggggcgttttatccattttccaggaaccac
aacacattcgggaccaggagacaagatcctgtggcctgggactcagcctttgagatgttc
tcaagaaaagtcctccagaccagatatactctgctgccttacctctacactctaatgcat
aaggctcacgctgagggcagcactgtggttcgaccccttctccatgagtttacagaggaa
cgcacaacatgggatatagaccatcagttcatgctgggccctgccatcttaattagccct
gtgctggaaaataatacttttcaggtccaggcttactttcccagagcccgttggtatgac
tacagcacgggatcgggcaatgaatcaacaggtgagtggaaagtcctggaggctcccttg
gaccatatcaacgttcatgtcagaggaggctacatcctgccttggcaagaacctgcgatg
aacactcagtccagccgacagaaatatatgggattgattgttgctttggatgacaatggg
agagctgaaggtcagctgttctgggatgatggacaaagcattgatacctttgaaaatgga
aactatttcttggtaaactttacagcagctcagagtgtactgcaaatccaaatgatacat
aataattatttgagtgacactaattcactgaaagttggatatattagtatctggggcata
aactctactgatataacacaagtgactgtctcctatgacaatcaacaattcatggtgatg
aatttcaagagtgacccttacaatcagacactaaatattcaattgactgacaagattatc
agcctggaaaagttaactgaggttacttggattcacggtggtcctatagtttctacgaca
gctatggcgagtaccttcccaatgagctcttcacgtccttccgcagcttctactgctgct
gctgcttctgacaccaccagttcctctgcttcaagtggcactggtaccagcaccgctgag
agcactagtgccgctcttcctacgacaaccacttctttcccaacaagcgctgctgaagtt
tcagctggtgctactgttgccaataccagtgcatctctccctacaaacactgctcctgag
agcactagtgttatgcttcccgccacaaccatgccttacccaacaagcgctaccgaggtt
tcaactagtaccactgtccctaataccactatacatttccctattaatactactactgat
agcactgatatcactcttcccatcacaaccatgccttacccaacaagtactgctgaattt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactgatatcactcttcccatcacaaccatgccttacccaacaagtactgctgaattt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactgatatcactcttcccatcacaaccatgccttacccaacaagtactgctgaattt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactgatatcactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactactgtccctaataccactatacatttccctattaatactactactgat
agcactaatgttactcttcccatcacaaccatgccttacccagcaagtactgctgaagtt
tcaactagtactatctgtccctaa

DBGET integrated database retrieval system