KEGG   Ovis aries (sheep): 101113846
Entry
101113846         CDS       T03117                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04218  Cellular senescence
oas04270  Vascular smooth muscle contraction
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04540  Gap junction
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04720  Long-term potentiation
oas04722  Neurotrophin signaling pathway
oas04730  Long-term depression
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04912  GnRH signaling pathway
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04921  Oxytocin signaling pathway
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas05010  Alzheimer disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05132  Salmonella infection
oas05135  Yersinia infection
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101113846 (MAP2K2)
   04012 ErbB signaling pathway
    101113846 (MAP2K2)
   04014 Ras signaling pathway
    101113846 (MAP2K2)
   04015 Rap1 signaling pathway
    101113846 (MAP2K2)
   04370 VEGF signaling pathway
    101113846 (MAP2K2)
   04371 Apelin signaling pathway
    101113846 (MAP2K2)
   04066 HIF-1 signaling pathway
    101113846 (MAP2K2)
   04068 FoxO signaling pathway
    101113846 (MAP2K2)
   04072 Phospholipase D signaling pathway
    101113846 (MAP2K2)
   04071 Sphingolipid signaling pathway
    101113846 (MAP2K2)
   04024 cAMP signaling pathway
    101113846 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    101113846 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    101113846 (MAP2K2)
   04150 mTOR signaling pathway
    101113846 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101113846 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    101113846 (MAP2K2)
   04218 Cellular senescence
    101113846 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101113846 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101113846 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101113846 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101113846 (MAP2K2)
   04620 Toll-like receptor signaling pathway
    101113846 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    101113846 (MAP2K2)
   04660 T cell receptor signaling pathway
    101113846 (MAP2K2)
   04662 B cell receptor signaling pathway
    101113846 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    101113846 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101113846 (MAP2K2)
   04929 GnRH secretion
    101113846 (MAP2K2)
   04912 GnRH signaling pathway
    101113846 (MAP2K2)
   04915 Estrogen signaling pathway
    101113846 (MAP2K2)
   04917 Prolactin signaling pathway
    101113846 (MAP2K2)
   04921 Oxytocin signaling pathway
    101113846 (MAP2K2)
   04926 Relaxin signaling pathway
    101113846 (MAP2K2)
   04935 Growth hormone synthesis, secretion and action
    101113846 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    101113846 (MAP2K2)
   04916 Melanogenesis
    101113846 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101113846 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    101113846 (MAP2K2)
   04730 Long-term depression
    101113846 (MAP2K2)
   04722 Neurotrophin signaling pathway
    101113846 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101113846 (MAP2K2)
   05206 MicroRNAs in cancer
    101113846 (MAP2K2)
   05205 Proteoglycans in cancer
    101113846 (MAP2K2)
   05230 Central carbon metabolism in cancer
    101113846 (MAP2K2)
   05231 Choline metabolism in cancer
    101113846 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101113846 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101113846 (MAP2K2)
   05225 Hepatocellular carcinoma
    101113846 (MAP2K2)
   05226 Gastric cancer
    101113846 (MAP2K2)
   05214 Glioma
    101113846 (MAP2K2)
   05216 Thyroid cancer
    101113846 (MAP2K2)
   05221 Acute myeloid leukemia
    101113846 (MAP2K2)
   05220 Chronic myeloid leukemia
    101113846 (MAP2K2)
   05218 Melanoma
    101113846 (MAP2K2)
   05211 Renal cell carcinoma
    101113846 (MAP2K2)
   05219 Bladder cancer
    101113846 (MAP2K2)
   05215 Prostate cancer
    101113846 (MAP2K2)
   05213 Endometrial cancer
    101113846 (MAP2K2)
   05224 Breast cancer
    101113846 (MAP2K2)
   05223 Non-small cell lung cancer
    101113846 (MAP2K2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101113846 (MAP2K2)
   05022 Pathways of neurodegeneration - multiple diseases
    101113846 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101113846 (MAP2K2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101113846 (MAP2K2)
   05135 Yersinia infection
    101113846 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101113846 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    101113846 (MAP2K2)
   05161 Hepatitis B
    101113846 (MAP2K2)
   05160 Hepatitis C
    101113846 (MAP2K2)
   05164 Influenza A
    101113846 (MAP2K2)
   05163 Human cytomegalovirus infection
    101113846 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101113846 (MAP2K2)
   05165 Human papillomavirus infection
    101113846 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101113846 (MAP2K2)
   01522 Endocrine resistance
    101113846 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101113846 (MAP2K2)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101113846 (MAP2K2)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: STE group
  STE7 family
   101113846 (MAP2K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 101113846
NCBI-ProteinID: XP_004008652
Ensembl: ENSOARG00000010782
UniProt: A0A6P3ECN2 W5PM87
LinkDB
Position
5
AA seq 400 aa
MLARRKPVLPALTINPAIAEGPSPTSEGASEAHLVDLQKKLEELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPPSISPRPRP
PGRPISGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTQDFQEFVNKCLIKNPAERADL
KMLMNHTFIKRSEVEEVDFAGWLCKTLRLNQPSTPTRTAV
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcaccatcaaccccgccattgccgag
ggtccgtcccccaccagcgagggcgcctccgaagcacacctggtggacctccagaagaag
ctggaggagctagagctcgacgagcagcagaagaagcggctggaagccttccttacccag
aaggccaaggttggcgagctcaaggacgatgacttcgaacggatctccgagctgggagcc
ggcaatggtggagtggtcaccaaggtccagcacagaccttcgggcctcatcatggccaga
aagctgatccacctggagatcaagccggccatccggaaccagatcatccgagagctgcag
gtgctgcacgagtgcaactccccgtacattgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggaacacatggatggcggctccctggaccaggtgttgaaa
gaagccaagagaatccccgaagagatcctgggcaaggtcagcatcgcggttctgcggggc
ctggcatacctccgggagaaacaccagatcatgcaccgagacgtgaagccatccaacatc
ctcgtcaactcccggggggagatcaagctgtgtgactttggggtgagcggccagctcatc
gactccatggccaactccttcgtgggcacgcggtcctacatgtctccggagcggctacaa
ggcacccactactcagtgcagtcagacatctggagcatgggcctgtccctggtggaactg
tccatcggaaggtaccccatccccccgccggacgccaaggagctggaggccatattcggt
cggcccatggttgatggcgcggaaggagaacctcccagcatctcaccacggccgaggccc
cccggacgccccatcagcggtcacgggatggacagccggccggccatggcgatctttgag
ctgctggactacattgtgaacgagcctcctcccaagctgcccaatggcgtgttcacccag
gacttccaggagtttgtaaataaatgcctaattaagaacccagctgagcgagcagacctg
aagatgctcatgaaccacaccttcatcaagcggtccgaggtggaagaagtggattttgct
ggctggttgtgtaaaacactgcggctaaaccagcccagcacgcccacacgcaccgccgtg
tga

KEGG   Ovis aries (sheep): 101123635
Entry
101123635         CDS       T03117                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X2
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04062  Chemokine signaling pathway
oas04066  HIF-1 signaling pathway
oas04068  FoxO signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04114  Oocyte meiosis
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04218  Cellular senescence
oas04270  Vascular smooth muscle contraction
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04380  Osteoclast differentiation
oas04510  Focal adhesion
oas04540  Gap junction
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04613  Neutrophil extracellular trap formation
oas04620  Toll-like receptor signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04666  Fc gamma R-mediated phagocytosis
oas04668  TNF signaling pathway
oas04720  Long-term potentiation
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04726  Serotonergic synapse
oas04730  Long-term depression
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04912  GnRH signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04921  Oxytocin signaling pathway
oas04926  Relaxin signaling pathway
oas04928  Parathyroid hormone synthesis, secretion and action
oas04929  GnRH secretion
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas05010  Alzheimer disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05034  Alcoholism
oas05132  Salmonella infection
oas05135  Yersinia infection
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05164  Influenza A
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101123635 (MAP2K1)
   04012 ErbB signaling pathway
    101123635 (MAP2K1)
   04014 Ras signaling pathway
    101123635 (MAP2K1)
   04015 Rap1 signaling pathway
    101123635 (MAP2K1)
   04370 VEGF signaling pathway
    101123635 (MAP2K1)
   04371 Apelin signaling pathway
    101123635 (MAP2K1)
   04668 TNF signaling pathway
    101123635 (MAP2K1)
   04066 HIF-1 signaling pathway
    101123635 (MAP2K1)
   04068 FoxO signaling pathway
    101123635 (MAP2K1)
   04072 Phospholipase D signaling pathway
    101123635 (MAP2K1)
   04071 Sphingolipid signaling pathway
    101123635 (MAP2K1)
   04024 cAMP signaling pathway
    101123635 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    101123635 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    101123635 (MAP2K1)
   04150 mTOR signaling pathway
    101123635 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101123635 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101123635 (MAP2K1)
   04210 Apoptosis
    101123635 (MAP2K1)
   04218 Cellular senescence
    101123635 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101123635 (MAP2K1)
   04540 Gap junction
    101123635 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101123635 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101123635 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    101123635 (MAP2K1)
   04620 Toll-like receptor signaling pathway
    101123635 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    101123635 (MAP2K1)
   04660 T cell receptor signaling pathway
    101123635 (MAP2K1)
   04662 B cell receptor signaling pathway
    101123635 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    101123635 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    101123635 (MAP2K1)
   04062 Chemokine signaling pathway
    101123635 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101123635 (MAP2K1)
   04929 GnRH secretion
    101123635 (MAP2K1)
   04912 GnRH signaling pathway
    101123635 (MAP2K1)
   04915 Estrogen signaling pathway
    101123635 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    101123635 (MAP2K1)
   04917 Prolactin signaling pathway
    101123635 (MAP2K1)
   04921 Oxytocin signaling pathway
    101123635 (MAP2K1)
   04926 Relaxin signaling pathway
    101123635 (MAP2K1)
   04935 Growth hormone synthesis, secretion and action
    101123635 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    101123635 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    101123635 (MAP2K1)
   04916 Melanogenesis
    101123635 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101123635 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    101123635 (MAP2K1)
   04726 Serotonergic synapse
    101123635 (MAP2K1)
   04720 Long-term potentiation
    101123635 (MAP2K1)
   04730 Long-term depression
    101123635 (MAP2K1)
   04722 Neurotrophin signaling pathway
    101123635 (MAP2K1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101123635 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101123635 (MAP2K1)
   05206 MicroRNAs in cancer
    101123635 (MAP2K1)
   05205 Proteoglycans in cancer
    101123635 (MAP2K1)
   05230 Central carbon metabolism in cancer
    101123635 (MAP2K1)
   05231 Choline metabolism in cancer
    101123635 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101123635 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101123635 (MAP2K1)
   05212 Pancreatic cancer
    101123635 (MAP2K1)
   05225 Hepatocellular carcinoma
    101123635 (MAP2K1)
   05226 Gastric cancer
    101123635 (MAP2K1)
   05214 Glioma
    101123635 (MAP2K1)
   05216 Thyroid cancer
    101123635 (MAP2K1)
   05221 Acute myeloid leukemia
    101123635 (MAP2K1)
   05220 Chronic myeloid leukemia
    101123635 (MAP2K1)
   05218 Melanoma
    101123635 (MAP2K1)
   05211 Renal cell carcinoma
    101123635 (MAP2K1)
   05219 Bladder cancer
    101123635 (MAP2K1)
   05215 Prostate cancer
    101123635 (MAP2K1)
   05213 Endometrial cancer
    101123635 (MAP2K1)
   05224 Breast cancer
    101123635 (MAP2K1)
   05223 Non-small cell lung cancer
    101123635 (MAP2K1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101123635 (MAP2K1)
   05022 Pathways of neurodegeneration - multiple diseases
    101123635 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    101123635 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101123635 (MAP2K1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101123635 (MAP2K1)
   05135 Yersinia infection
    101123635 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101123635 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    101123635 (MAP2K1)
   05161 Hepatitis B
    101123635 (MAP2K1)
   05160 Hepatitis C
    101123635 (MAP2K1)
   05164 Influenza A
    101123635 (MAP2K1)
   05163 Human cytomegalovirus infection
    101123635 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101123635 (MAP2K1)
   05165 Human papillomavirus infection
    101123635 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101123635 (MAP2K1)
   01522 Endocrine resistance
    101123635 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101123635 (MAP2K1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101123635 (MAP2K1)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: STE group
  STE7 family
   101123635 (MAP2K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 101123635
NCBI-ProteinID: XP_012036192
UniProt: A0A6P3TF96
LinkDB
Position
7
AA seq 391 aa
MCRGAATSSVCRMHSCRAPEMKLERTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGE
LKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECN
SPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLRE
KHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSV
QSDIWSMGLSLVEMAVGRYPIPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGM
DSRPPMAIFELLDYIVNEPPPKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIK
RSDAEEVDFAGWLCSTIGLNQPSTPTHAAGV
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgtgtagaggagcggcaactagttcagtgtgccggatgcatagctgcagggcgccggag
atgaagctggagaggaccaatctggaggccttgcagaagaagctggaggagctggagctc
gatgaacagcagcggaagcgcctcgaggcctttctgacccagaagcagaaggtgggggaa
ctgaaggatgatgactttgagaagatcagtgagctgggtgccggcaatggaggtgtggtg
ttcaaggtctcccacaagccgtccggactcgttatggccagaaagctaattcacctggag
atcaaacctgccatccggaaccagatcataagggagctgcaggttctccatgagtgcaac
tcgccatacatcgtgggcttctacggggccttctacagcgacggcgagatcagcatctgc
atggagcacatggatgggggttccttggatcaagttctgaagaaagctggaagaattcct
gaacaaattttaggaaaagttagcattgctgtaataaaaggcctgacatacctgagggag
aagcacaagattatgcacagagatgtcaagccgtccaacatcctagtgaacagccgtggg
gagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggccaactct
ttcgtgggcaccaggtcctacatgtcgccagagcgactccaggggacccattactccgtg
cagtcggacatctggagcatggggctctctctggttgagatggcggtcgggaggtatccc
atccctcctccagatgccaaggagctggagctgatgtttgggtgccaggtggagggagat
gcggctgagaccccacccaggccaaggacccccgggaggcccctcagctcttatggaatg
gacagccgacctccaatggcaatttttgagctgttggattacatagtcaatgagcctcct
ccaaaactgcccagtggagtattcagtctggaatttcaagattttgtgaataaatgctta
ataaaaaaccccgcagagagagcagatctgaagcaactcatggttcatgcttttatcaag
agatctgatgctgaggaagtggattttgcaggttggctctgctccaccatcggccttaac
cagcccagcacacccacccatgcagctggtgtctaa

DBGET integrated database retrieval system