KEGG   Ovis aries (sheep): 101113936Help
Entry
101113936         CDS       T03117                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
oas  Ovis aries (sheep)
Pathway
oas00350  Tyrosine metabolism
oas01100  Metabolic pathways
Module
oas_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101113936 (GSTZ1)
Enzymes [BR:oas01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     101113936 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Tom37 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 101113936
NCBI-ProteinID: XP_004010861
Ensembl: ENSOARG00000002420
UniProt: W5NWM7
LinkDB All DBs
Position
7
AA seq 216 aa AA seqDB search
MQVGKPILYSYFRSSCSWRVRIALALKNIDYETVAVNLTKDGGQQFSEEFQALNPMKQVP
ALKIDGITISQSLAIIEYLEETRPTPRLLPQDPKKRAQVRMVSDLIASGIQPLQNLSVLK
QVGQENQLTWAQQAITSGFNALEQTLQSTAGRFCVGDEVSMADLCLAPQVANADRFKVDL
TPYPNISRINKSLLALEAFHVSHPCRQPDTPPELRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtggggaagcccatcctgtattcctatttccgaagctcctgctcatggagagtt
cgaatcgctctggccttgaaaaacatcgactatgagacagtagccgtcaacctcacaaag
gatgggggccagcagttctctgaagaatttcaggccctgaatcccatgaagcaggtgcca
gccctgaagattgatggaatcaccatcagccagtccctggccatcatcgagtatctggag
gagaccaggcccacgccgcgactcctgcctcaggacccgaagaagagggcccaggtgcgc
atggtgtctgacctcatcgccagcggcatccagcccctgcagaacctgtctgtcctgaag
caggtgggacaggagaaccagctgacctgggcccagcaggccatcacttctggctttaat
gctctggagcagaccctgcagagcacggcggggaggttctgtgtgggggacgaggtgtcc
atggctgacctgtgcttagcgcctcaggtggcaaatgctgacaggttcaaggtggacctc
actccctaccctaacatcagccgcatcaacaagtcgctgctggccttggaggccttccac
gtgtctcacccctgtcggcagccggatacacccccggagctgagggcctag

DBGET integrated database retrieval system