KEGG   Ovis aries (sheep): 101113985
Entry
101113985         CDS       T03117                                 

Gene name
DAPK1
Definition
(RefSeq) death-associated protein kinase 1 isoform X1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas04140  Autophagy - animal
oas05200  Pathways in cancer
oas05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101113985 (DAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101113985 (DAPK1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101113985 (DAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101113985 (DAPK1)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101113985 (DAPK1)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   101113985 (DAPK1)
SSDB
Motif
Pfam: Pkinase Ank_2 Ank_5 Ank_4 Ank PK_Tyr_Ser-Thr Ank_3 Death COR Kdo RIO1 AAA_23 Choline_kinase APH ABC_tran DUF3847
Other DBs
NCBI-GeneID: 101113985
NCBI-ProteinID: XP_027820043
Ensembl: ENSOARG00000008706
UniProt: A0A6P7DN22
LinkDB
Position
2
AA seq 1440 aa
MTVFRQENVDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSLQIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEY
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIHAINDDNVPGL
QHLLGSLSNYDVNQPNKHGTPPLLIAAGCGNIQILQLLIKRGSRIDIQDKGGSNAIYWAS
RHGHVDTLKFLNENKCPLDVKDKSGETALHVAARYGHADVVQLLCSFGSNPNFQDKEEET
PLHCAAWHGYYSVAKALCEAGCNVNIKNREGETPLLTASARGYQDIVECLAEHGADLNAS
DKDGHIALHLAVRRCQMEVIQTLISQGCSVDFQDRHGNTPLHVACKDGNVPIVVALCEAN
CNLDLSNKYGRTPLHLAANNGILDVVRYLCLMGANVEALTSDGKTAEDLAKSEQHEHVAG
LLTRLRKDTHRGLFIQQLRPTQNLQPRIKLKLFGHSGSGKTTLVESLKCGLLRSFFRRRR
PRLSSTNSTRFPPSPLASKPAVSVSINNLYPGCENVSVRSRSMMFEPGLTKGVLEVFGAP
SHHPHCTTDDQSTKAIDIQNAYLNGIGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVIVF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGKLKNPLRVVLVATHADIVNLPRSAGG
EFGYDKDTSLLKEIRNRFGNDLHISNKLFVLDAGASGSKDMKVLRNHLQEIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVYDVQDQLNPLASEADLRHIAQQLHSAGE
INIMQSETVQDVLLLDPRWLCTNVLGKLLSVETPRALHHYRGRYTMEDVQRLVPDSDVEE
LLQILDAMDICARDLSSGTMVDIPALIKTDNLHRSWTDEEDEVRVYGGVRVVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSAEGDADIRLWVNGCKIANRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCFLLDSVCSTIENVMTTTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPDLVAKYNTNNGSPKEFLPSPVHALLREWTSYPESTVGILMSKL
RELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSRKNSHVRNPTV
NT seq 4323 nt   +upstreamnt  +downstreamnt
atgaccgtgttcaggcaggaaaacgtggatgattactacgacaccggcgaggaacttggc
agtgggcagtttgccgtcgtgaagaaatgccgtgagaaaagcaccggtctacagtatgcc
gccaaattcatcaagaaaaggaggaccaaatccagccggcggggcgtgagccgcgaggac
atcgagcgggaagtcagcatcctaaaggagatccagcaccccaacgtcatcaccctgcac
gaggtttacgagaacaagacggacgtcatcctgatcctggaactcgttgcaggtggtgag
ctgtttgacttcttagctgaaaaggaatctttgactgaagaggaagcaactgaatttctc
aaacaaattcttaatggtgtttactatctgcactcccttcagattgcccactttgatctt
aagcctgagaacataatgcttttggatagaaatgttcccaagcctcggatcaagatcatt
gactttgggttggcccataaaattgactttggaaatgaattcaaaaatatatttgggaca
ccagaatttgttgctcctgagatagtcaactatgaacctcttggtcttgaggcagatatg
tggagtattggggtaataacctatattctcctcagtggggcctccccgtttctcggagac
actaagcaagaaacattagcgaacgtatctgctgtcaactatgaatttgaggaagagtac
ttcagtaatacgagtgccctagccaaagatttcataagaagactcctcgtcaaggatcca
aagaagagaatgacaattcaggacagtttgcagcatccctggatcaagcctaaagatacc
caacaagcacttagtagaaaagcatcggcagtaaacatggagaaattcaagaagtttgca
gcccggaaaaaatggaaacaatctgttcgcttgatatcactgtgccaaagattatccagg
tcattcttgtccagaagtaacatgagtgttgccagaagcgatgatactctggacgaggaa
gactcctttgtgatgaaagctatcatccatgccatcaacgacgataatgtcccaggcctg
cagcacctcctgggctccttgtccaactacgacgttaaccagcccaacaagcatgggact
cctccgttacttattgctgctggctgtgggaatattcaaatactacagttgctcattaag
agaggctcaagaattgacatccaggataagggtggatccaatgccatctactgggcctct
cggcatggccatgtagataccttgaaatttctcaatgagaacaaatgccctctggacgtt
aaagacaagtctggagagacagcccttcatgtggcagctcgctacggccatgctgatgtg
gttcagttactgtgcagcttcggctcgaatcccaacttccaggacaaggaagaagaaacc
cccctgcactgtgctgcctggcacggctattactctgtggccaaagccctttgtgaagcc
ggctgcaatgtgaacattaagaacagagaaggcgagacccccctcctgacagcctccgcc
aggggctaccaagacatcgtggagtgtctggctgagcacggagccgaccttaatgcatcc
gacaaggatggacacattgctctacatcttgccgtgagacgatgtcagatggaggtcatc
cagactctcatcagccaaggctgttcagtcgatttccaagacaggcatggcaacaccccc
ctccatgtggcctgcaaagatggcaatgtgccgattgtggtagccctctgtgaagccaac
tgcaatttggatctctccaacaagtatggacggacgcctctgcaccttgccgccaacaac
gggattctggacgtggtccgctacctgtgtctgatgggcgccaatgtggaggcgctgacc
tcggatggaaagacagcagaagatcttgcgaaatctgaacagcatgaacacgtagcaggc
ctcctcacgagactccgaaaggacacacaccgaggactcttcatccagcaactgcgaccc
acacagaacctgcagccaagaatcaagctgaagcttttcggccactcggggtctgggaag
accactctggtggaatctctgaagtgtgggctgctgaggagcttcttccgaagacgccgg
ccccggctctcctccaccaactctacccggttcccaccctcgcccctggcctccaagccg
gcagtgtccgtgagcatcaacaacctgtacccaggctgtgagaacgtgagcgtcaggagc
cgcagcatgatgttcgagccgggccttaccaagggggtgctggaggtgtttggggccccg
tcccaccacccgcactgcaccaccgatgaccagtccacgaaggcaatcgacatccagaat
gcctatctgaacggcattggtgacttcagtgtgtgggagttctctggaaatcctgtctac
ttctgctgttatgactattttgctgcaaacgatcccacgtccatccatgtcatcgttttc
agtctagaagagccctatgagattcagctgaaccaagtgattttctggcttagtttcctg
aagtctcttgtcccagtggaagaaccgatagcctttggcggcaagctgaaaaacccactc
cgagttgtcctggtggccacccatgctgacatcgtgaaccttcctcgttcagctggaggc
gagtttggatatgacaaagacacttcgttgctgaaagagatcaggaacaggtttgggaac
gatcttcacatttcaaataagctctttgttctggatgccggggcttctgggtctaaggac
atgaaggtactccgaaatcacctgcaagaaatacggagccagattgtttcggtctgccct
ccaatgactcacctatgtgaaaagatcatctccactttgccctcctggaggaagctcaat
ggccccaaccagctgatgtcactgcagcagttcgtgtatgacgtacaggaccagttgaac
cccctggccagtgaggcagacctccggcacatcgcccagcagctccacagtgctggcgag
atcaacatcatgcagagcgaaaccgtccaggacgtgctgctcctggatccccgctggctg
tgcaccaacgttctggggaagctgctctctgtggagaccccacgggccctgcaccattac
cgcggccgctacaccatggaggacgtccagcgcctggtgcccgacagcgacgtggaggag
ctgctgcagatcctggatgccatggacatctgcgcgcgggacctgagcagcgggaccatg
gtggacatccccgccctgatcaagactgacaacctgcaccgctcctggacggacgaggag
gacgaggtgcgggtctacggcggcgtgcgcgtcgtcccggtggagcacctcacgcccttc
ccctgtggcatcttccacaaggtgcaggtgaacctgtgccggtggatccaccagcagagc
gccgagggagacgcggacattcgcctgtgggtgaacggctgcaaaatcgccaaccgcggg
gccgagctgctggtgctgctggtcaaccacggccagggcatagaggtccaggtgcgtggc
ctggagacggagaagatcaagtgctgcttcctgctggactcggtgtgcagcaccatcgag
aacgtcatgaccaccacgctgcccgggctgctgacggtgaagcactacctgagcccccag
cagctgcgagagcaccacgagcccgtcatgatctaccagccccgggacttcttccgggcg
cagactctcaaggagacctcactgaccaacaccatgggcgggtacaaggagagcttcagc
agcatcatgtgcttcggctgtcacgacgtctactcgcaggccagcctgggcatggacatc
cacgcgtcagatctgaacctcctgacccggaggaaactcagtcgcctgctggacccgccc
gaccccatggggaaggactggtgcctccttgccatgaacttgggcctccccgatcttgtg
gccaagtacaataccaataacgggtctcccaaggagttcctcccgagcccagtccacgcc
ctgctccgagaatggacttcctaccccgagagcactgtcggcattctcatgtccaaactg
cgggagctggggcgtcgggacgccgcggacttcctgctgaaggcgtcctctgtgttcaaa
atcaacctcgacggcaacggccaggaggcctacgcctcaagctgcaacagtggcacatct
tacaattccattagctcggtcgtgtcccggaaaaactcccatgtaaggaatcccactgta
tga

KEGG   Ovis aries (sheep): 101114352
Entry
101114352         CDS       T03117                                 

Gene name
DAPK3
Definition
(RefSeq) death-associated protein kinase 3
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas04140  Autophagy - animal
oas05200  Pathways in cancer
oas05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101114352 (DAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101114352 (DAPK3)
  09162 Cancer: specific types
   05219 Bladder cancer
    101114352 (DAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101114352 (DAPK3)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101114352 (DAPK3)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   101114352 (DAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 Choline_kinase APH OmpH DUF3847
Other DBs
NCBI-GeneID: 101114352
NCBI-ProteinID: XP_027825665
Ensembl: ENSOARG00000011263
UniProt: A0A6P7E3I9
LinkDB
Position
5
AA seq 454 aa
MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREE
IEREVNILREIRHPNIITLHDIFENRTDVVLILELVSGGELFDFLAEKESLTEDEATQFL
KQILDGVHYLHSKRIAHFDLKPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGETKQETLTNISAVNYDFDEEY
FSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRRRNVRREDSGRKPERRRLKTA
RLKEYTIKSHSSMPPNNTYINFERFSKVLEEVAAAEEGLRGLEHSRRLFHEDLEALTAIY
EEKEAWYREENESLGQDLRRLRQELHKTEALQRQAQEEAKGALLGASGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRAMEQEKLQEGECSLR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtcaacattcaggcaggaggatgtggaagaccactatgagatgggagaggagctggga
agcggacagtttgcgattgtgcggaagtgccggcagaagggtactgggaaggagtatgca
gccaagttcatcaagaagcgccgcctgtcgtccagccgccggggagtgagccgagaggag
atcgagcgggaggtgaacatcctgcgggagatccggcaccccaacatcatcacactgcat
gacatctttgagaacaggacagatgtggtgctcatcctcgagctggtctcaggcggtgag
ctctttgacttcctggccgagaaggagtcactgaccgaggacgaggctacccagttcctc
aagcagatcctggacggtgtccactatctgcactccaagcgcatcgcccacttcgacctc
aagccagaaaacatcatgctcctggacaagaatgtgcccaacccacggatcaagctcatt
gactttggcatcgcccacaagatcgaggcagggaatgagttcaagaacatctttgggacc
ccggagtttgtggctcctgaaatcgtcaactatgagcccctgggtctggaggcagacatg
tggagcattggcgtcatcacctacatcctgctgagtggcgcatccccattcctgggtgaa
accaagcaggagacgttgaccaacatctcggctgtgaactacgactttgacgaggagtac
ttcagcaacaccagcgagctggccaaggacttcatccgccgtctgcttgtcaaagacccc
aagaggagaatgaccatcgcccagagcctggagcattcctggatcaaggccatccggcgg
cgaaatgtacggcgggaagacagcggccggaagccagagcggcggcgcctgaagacggca
cgcctcaaggagtacaccatcaagtcacactcgagcatgccccccaacaacacctacatc
aacttcgagcgcttctccaaagtgctggaggaggtggcggcagccgaggagggcctgcgc
gggctggagcacagccgacgcctgttccatgaggaccttgaggcgctgacggccatctac
gaggagaaggaggcctggtaccgtgaggagaatgagagcctaggccaggacctgcggcgg
ctgcgccaggagctgcacaagacggaggcgctgcagcggcaggcacaggaggaggccaag
ggggccctgctcggggccagtgggctcaagcgccgctttagccgcctggagaaccgctac
gaggcactggccaagcaggtggcctctgagatgcggttcgtgcaggatctggtgcgtgcc
atggagcaggagaagctgcaggagggggagtgcagtctccgctag

KEGG   Ovis aries (sheep): 101123304
Entry
101123304         CDS       T03117                                 

Gene name
DAPK2
Definition
(RefSeq) death-associated protein kinase 2 isoform X1
  KO
K08803  death-associated protein kinase [EC:2.7.11.1]
Organism
oas  Ovis aries (sheep)
Pathway
oas04140  Autophagy - animal
oas05200  Pathways in cancer
oas05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101123304 (DAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101123304 (DAPK2)
  09162 Cancer: specific types
   05219 Bladder cancer
    101123304 (DAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:oas01001]
    101123304 (DAPK2)
Enzymes [BR:oas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101123304 (DAPK2)
Protein kinases [BR:oas01001]
 Serine/threonine kinases: CAMK group
  DAPK family
   101123304 (DAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Kdo DHR10 Spc7 PI3K_P85_iSH2 TPR_MLP1_2 Lectin_N
Other DBs
NCBI-GeneID: 101123304
NCBI-ProteinID: XP_014952471
UniProt: A0A6P3YK52
LinkDB
Position
7
AA seq 483 aa
MRSPNMETFRQQKVEDFYDIGEELGSGQFAIVKKCREKSTGLEYAAKFIKKRQSPASRRG
VCRVEIEREVSILRKVLHPNVITLHDVFENRTDVVLILELVSGGELFDFLAQKESLSEEE
ATSFIKQILEGVNYLHAKKIAHFDLKPENIMLLDKNIPIPHIKLIDFGLAHEIEDGVEFK
NIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANITAVSYD
FDEEFFSQTSELAKDFIRKLLVKETRKRLTIQEALRHPWITSKGEIRAPEQHKAEPIQLK
TKRLREYTLKCHSSMPPNNTYVNFERFARVVEDVAQVEQGCRALTGTHDTIQDDVETLIS
IYNEKEAWYREESERARHDLSQLRYEFRKVKSSKKLLREDIRATGSRLGGAARKLDHLQT
QFETLRQELSADLRWLQELVGSFQMESGSVDSPGSMFCRDASESLGELLNRSCGEGVLAG
LKL
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgaggagcccgaacatggagacgttcaggcagcagaaggtggaggacttttatgacatc
ggggaggagctggggagcggccagttcgccattgtgaagaagtgccgagagaagagcacg
gggctggagtacgcagccaagttcatcaaaaagcggcagagcccggccagccggcggggc
gtgtgtcgggtggagattgagcgggaggtgagcatcctgcggaaggtcctgcaccccaac
gtcatcacgctgcacgacgtcttcgagaaccgcaccgacgtggtactcatcctcgagcta
gtgtccggaggagagctcttcgacttcttggcccagaaggaatccctgagtgaggaggag
gccaccagcttcattaagcagatcctggaaggggtgaactaccttcatgccaagaaaatc
gctcactttgatctcaagccagaaaacattatgttgttggacaagaatattcccattcca
cacatcaagctgattgactttggcctggctcatgaaatagaagatggagttgaatttaag
aacatttttgggacaccagaatttgttgctccagaaattgtgaactatgagcccctggga
ctggaggctgacatgtggagcatcggtgtcatcacctacatcctccttagtggagcatcc
cctttcctgggagacacgaagcaggaaacgctagcaaatatcacagcagtgagttacgac
tttgacgaggaattcttcagccagaccagcgagctggccaaggacttcattcggaagctt
ctggttaaagagacccggaagcggctcacgatccaagaggctctcagacatccctggatc
acgtccaaaggagagatcagagccccagaacagcacaaggcagagcccatccagctgaag
accaagcgcctgagagagtacaccctcaaatgccactcaagcatgccccccaacaacacc
tatgtcaacttcgagcgctttgcccgtgtggtcgaggatgtggctcaggtggagcagggc
tgccgggccctgacaggaacccatgacaccatccaggacgatgtggagaccctgatctcc
atctacaatgagaaggaggcttggtaccgggaggagagcgagagagcccggcacgacctg
tctcagctcaggtacgagttccgcaaggtgaagtcctcgaagaagctccttcgagaggac
atccgggccacagggtcccgccttgggggcgcagccaggaagctggaccacctgcagacg
cagtttgagaccctgaggcaggagctctcagcagacctccggtggctccaggaactggtg
ggcagcttccagatggagagtgggagcgtggacagcccaggttccatgttctgcagggac
gccagtgagtcccttggagagctgctcaacagatcatgtggcgagggagtcttggccggc
ttgaaactctga

DBGET integrated database retrieval system