KEGG   Ovis aries (sheep): 101113991
Entry
101113991         CDS       T03117                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
oas  Ovis aries (sheep)
Pathway
oas04060  Cytokine-cytokine receptor interaction
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04630  JAK-STAT signaling pathway
oas04640  Hematopoietic cell lineage
oas05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101113991 (IL3RA)
   04151 PI3K-Akt signaling pathway
    101113991 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101113991 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101113991 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101113991 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101113991 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:oas04050]
    101113991 (IL3RA)
   04090 CD molecules [BR:oas04090]
    101113991 (IL3RA)
Cytokine receptors [BR:oas04050]
 Interleukin receptor families
  IL3 receptor family
   101113991 (IL3RA)
CD molecules [BR:oas04090]
 Proteins
  101113991 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 101113991
NCBI-ProteinID: XP_027819123
LinkDB
Position
X
AA seq 379 aa
MALPGLAALLILICCSMTTDHAISDPDPPIKNLRIDPERKRLVWDQHGNVSEIGCYVNSK
ILRKATKNPYCTLGDLSCEVKNYTVKVMKGQPFSDWILYPTQGNPRAAADNLTCRVHDVD
QLSCSWAVGEEAPADVQYQFYLQQSVETWQCPKYTQNQQGVNVQCHFDSISLHPQRQAQF
RFLVNGTSGDSEIPCRVMIHRLQEIEILAAPNITKKWCNENDSFMEWEVRSLFTEDIKYE
LEIQKGTDLAYKEETELKSLRLRNPGPYTVKVKAMDSLFFGRRPPGQWSAPQHLDCGSKN
ASFPFWLVYLLAPLGALLLVGLVFLCRRWPVVQKLFPRVPHVKDPVGDSFQNERMMAWDP
EQESQEECPVVQVQVLGEA
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggccctccccgggctggccgcgctcctgatactcatctgctgctcgatgaccacggac
cacgccatctctgatccagacccaccgattaagaacttaaggatagatccagaaagaaaa
agattggtctgggaccagcacggaaatgtttctgaaattgggtgttacgtcaattcgaaa
attttaagaaaggcaacaaagaacccctattgcactcttggcgacttgtcatgcgaagtg
aaaaactataccgtgaaggtgatgaaaggccaaccgttctctgactggattctgtatcca
acacaaggcaacccccgggcggccgcggacaacctgacctgccgggtgcacgacgtggat
cagctcagctgcagctgggcggtgggcgaggaggccccggcggacgtgcaataccagttc
tacctgcagcagtccgtggagacgtggcagtgtcccaagtacacgcagaaccagcagggc
gtcaacgtccagtgccattttgacagcatctcccttcatcctcaacgccaagctcagttt
cgtttcctggtgaatggtaccagcggtgactccgaaatcccctgccgcgtaatgattcat
agattgcaagaaattgaaatattagctgccccgaacatcacaaaaaagtggtgtaacgaa
aacgactctttcatggaatgggaagtaaggagtctctttactgaagacatcaagtatgag
cttgagatacagaagggcacggacctcgcctacaaagaggagacggagctcaagtccttg
aggctgaggaacccgggaccctacacggtgaaggtcaaggccatggactccctgtttttt
gggagaagaccgccgggccagtggagcgccccgcagcacctcgactgtggcagcaagaac
gcgtccttcccgttctggctggtgtacctgctggccccgctcggggcgctgctcctggtg
gggctcgtgttcctctgtcgcaggtggccggtggtgcagaagctcttcccgcgtgtccct
cacgtgaaagacccggtcggcgacagctttcagaacgagaggatgatggcctgggacccc
gagcaggagagccaggaggagtgtccggtggtccaggtgcaggtgttgggggaagcatga

DBGET integrated database retrieval system