KEGG   Ovis aries (sheep): 101114031
Entry
101114031         CDS       T03117                                 

Gene name
ERCC5
Definition
(RefSeq) DNA repair protein complementing XP-G cells isoform X1
  KO
K10846  DNA excision repair protein ERCC-5
Organism
oas  Ovis aries (sheep)
Pathway
oas03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    101114031 (ERCC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101114031 (ERCC5)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101114031 (ERCC5)
SSDB
Motif
Pfam: XPG_N XPG_I
Other DBs
NCBI-GeneID: 101114031
NCBI-ProteinID: XP_004012399
Ensembl: ENSOARG00000005295
LinkDB
Position
10
AA seq 1190 aa
MGVQGLWKLLECSGRQISPETLEGKILAVDISIWLNQALKGVRDRHGNSIENAHLLTLFH
RLCKLLFFRIRPIFVFDGDAPLLKKQTLAKRRHKKDLAASDSKTTTEKLLKTFLKRQVIK
TALKSKREETLPSLTQVQRDDIYALPPLQEREKNSSEEEDEKEWQERMSQKQALQEEFFH
NPHAVDIESEDFNSLPLEVKHEILTDMKEFTKRRRTLFEAMPEESNDFSQYQLKGLLKKN
YLNQHIENVEKEMNQQHSGKIQRQYEDEGGFLKEVESRRVVSEDTSHYILIKGVQVQKVT
EADSESLPSCSAKHSGALDTKSPPCEKLKPKKEPDTSPPSPRTLLAMQAALLGSSSEDEL
EGKHRRPCDVKSPPAPTSEGSVSPLTLLAIQRALDDDDEDLKVHAGVQTEGVGRRKPRPL
VSSSDEEAVEEPEVRDGDGELLTAAPRAASVTLTEEHVTKTSDEKEQTDSAPLLQTVFCQ
GSESSFPKEQTPSMHALKEPFQTSAESTAQDGKDLVPHRDVPGLPGGPEQIPTPPASPSS
GSRSGTYTRVSKPQQALPPESKHDTSVLSSDDEAESEKNPAPDIVGTTSLQESSNILSVA
IDTVSDLGNEAPISAPEHENFLKTIQEHKSVESVGQGLILVPESTEPTEVDSEDSESDGS
FIEVQNISSSDELRAELQEASRPPSGQGEEEPTGTEKEEATSDSEGLPREISESEAVAIE
RREETEKDAEDSLHEWQDIDLDELEALESNLLTQQNSLKAQKQQQERVAATVTGQMFLES
QELLRLFGIPYIEAPMEAEAQCAILDLTDQTSGTITDDSDIWLFGARHVYKNFFNKNKFV
EYYQYVDFHNQLGLDRNKLINLAYLLGSDYTEGIPTVGCVTAMEILNEFPGHGLEPLQKF
SEWWHEAQENKKIRPNPYDTKVKKKLRKLQLTPGFPNPAVADAYLKPVVDESKGSFLWGK
PDLDKIREFCQRYFGWNRTKTDESLFPVLKQLNVHQTQLRIDSFFRLAQQEKQEAKGIKS
QRLNRAVTCMLRKEREAAASEIEAASVAMEKESEFLDEAKGKTQKRGTANRWEEPSSPKR
KRLLDSKGGNESGGFLGEAYLSQSSEASSSEDAEYFPAMGVQRMKASGGSRARSSDARST
AQPASRRDGGTTTSSSSEDDDGGRAKPVLVTARPVFGKKKRRRRGTRGRK
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgggagtccaggggctctggaagctgttggagtgctccgggcggcagatcagcccggag
acgctggaggggaagatccttgccgtggatattagcatctggttaaaccaggctcttaaa
ggagtccgcgatcgccacgggaactcgatagaaaacgcccatcttctcactttgttccac
cgactctgcaaactcttatttttccgaattcgtcctatttttgtgtttgatggggatgcg
ccactgttgaagaaacagacattggctaagagaaggcataaaaaggacttggctgccagt
gactccaaaacaactacagagaagcttttgaaaacatttttgaaaagacaggttatcaaa
actgccttaaaaagcaaaagggaggaaacccttcccagtcttactcaagttcagagagat
gacatctatgctttgccacctttacaagagagagagaaaaacagttcagaagaggaggat
gaaaaagaatggcaagaaaggatgagtcagaaacaggcattacaggaagagttctttcac
aatcctcatgcagttgacattgagtctgaagatttcaacagcctgccccttgaagtaaag
catgaaatcttgactgatatgaaggaatttactaagcggagaagaacattatttgaagcg
atgccagaggagtctaatgacttttcacagtaccagctaaaaggcttgcttaaaaaaaac
tatctaaaccaacacatagaaaacgtcgagaaggaaatgaatcaacaacattcagggaaa
atccaaaggcagtatgaagatgaaggaggctttctgaaggaggtggagtccaggagagtg
gtctccgaggacacgtcccactacatcttgattaaaggtgttcaagttcagaaagtcaca
gaagcggattcagagtccctgccttcttgcagcgcaaagcatagtggggctttagacacg
aagtcacctccgtgtgaaaaactgaagccaaagaaagaacccgacacctcccctccctcc
ccgagaaccttgctggccatgcaggctgctctgttgggcagtagctcagaagatgagctg
gagggcaagcatcgcaggccgtgcgatgtgaagagcccaccagctcccacctctgagggt
tctgtgtccccgctgaccctcttggccattcagagagctctcgatgacgacgatgaagat
ctgaaagtgcatgccggtgtgcagacagagggggtgggcaggagaaaaccaagaccgctg
gtgagcagttctgatgaggaagctgtggaagaacctgaagtgagagatggagacggagag
ctgttgacggcagcgcctcgtgctgccagtgtgaccctcacagaggagcatgtgaccaag
accagtgatgaaaaagagcagacagactcagctcctttactgcagactgtcttttgtcaa
ggcagcgagtctagctttccaaaagaacagacgccatctatgcacgcgttgaaggaaccc
tttcagaccagcgctgagtctacagctcaggatggaaaagatctggtgccacacagggat
gtgcctgggctcccggggggaccagagcagataccaacacctccagcaagtccaagttct
gggtcaaggagtgggacatacaccagagtgtccaagccacagcaggctcttccacccgag
agtaagcatgacacctctgttctatcaagtgatgacgaagcagaatctgaaaaaaatcct
gcccctgacatcgttggcaccaccagtttgcaagaatcgagtaacatcctgagtgtcgct
atagacacagtaagtgacttaggaaatgaggcacctattagtgccccagagcatgagaat
ttcttgaaaaccatccaagaacacaagtccgttgaatctgtaggccagggtttgattttg
gtgccagagtccacggaaccaacggaagtagactccgaagacagtgaatctgatggaagc
ttcattgaagtgcagaatataagtagcagtgatgaacttcgagccgagttacaggaagct
tccagacctccctctggacaaggtgaggaggaaccgacaggaactgagaaggaagaagcc
accagtgactctgagggcctcccaagagagatttctgagagtgaggccgtggctattgag
agacgcgaagagactgagaaagatgcagaggattcgctccacgagtggcaagacatcgat
ctggacgagctggaagctctggagagcaacctcttaacccagcagaattcactgaaagct
caaaaacagcagcaagagcgggtggccgctactgtgacggggcagatgttcttggaaagc
caggaactgctccgcctcttcggcatcccctacatcgaggctcccatggaagcagaggct
cagtgcgccatcctggatctgaccgaccagacttccggaaccatcaccgatgatagtgat
atttggctattcggggcacggcacgtctacaaaaacttcttcaataaaaacaagtttgta
gaatattaccagtatgtggactttcacaaccaattaggattggaccggaacaaattaata
aatttggcctatttgcttggaagtgattatacagaaggaataccaactgtgggttgtgtt
accgccatggaaattctcaacgaattccctggacacggcctggaaccactccaaaaattc
tcagagtggtggcacgaagcccaggagaataagaagataaggccgaatccatatgacacc
aaagtgaaaaaaaagttgcgcaagttgcaactcacacctggcttccctaacccggccgtg
gcggacgcttacctcaagcctgtggtggacgagtccaaggggtcatttctgtggggcaaa
cccgacctggacaagatcagagaattttgtcagcggtattttggctggaacaggacgaag
acagatgaatctctgtttcctgtattaaagcaactgaatgtccatcagacacagctccga
attgattctttctttagattagcccaacaggagaaacaggaggccaagggtattaagagc
cagaggcttaacagagctgtgacatgtatgctgagaaaagagagagaagcagcagccagt
gagatagaagcagcttctgttgccatggagaaagagtctgagttccttgatgaggcaaaa
ggaaaaacccagaagagaggcacagcaaatagatgggaagagccatccagcccgaaaaga
aagaggcttttggattctaaaggagggaacgaaagtggtgggtttttgggggaggcctac
ctctcgcagtcatccgaggcctcttcaagtgaggatgcggagtacttccctgcgatgggc
gtgcaaaggatgaaagcatccggggggtcccgggcccgctcgtcagatgcacggagcaca
gcacagcctgcttcccggagggacggcgggaccaccacgagcagctccagcgaggacgac
gatggagggagggcgaagcccgtcctggtgaccgccaggcctgtgtttgggaagaaaaag
aggagacggagaggcacgagaggaaggaagtag

DBGET integrated database retrieval system