KEGG   Ovis aries (sheep): 101114274Help
Entry
101114274         CDS       T03117                                 

Gene name
TGM1
Definition
(RefSeq) LOW QUALITY PROTEIN: protein-glutamine gamma-glutamyltransferase K
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101114274 (TGM1)
Enzymes [BR:oas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101114274 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core DUF11
Motif
Other DBs
NCBI-GeneID: 101114274
NCBI-ProteinID: XP_004010350
Ensembl: ENSOARG00000019146
LinkDB All DBs
Position
7
AA seq 790 aa AA seqDB search
MSSPTPSSGGPRSDXGRWGGNPWRPPTTPSPEPEPEPDRRSRRGGRSFWARCCGCCSCRN
SRRPGSRGSAVNAAGDGTIRDGMLVVTGMDLLSSRSDQNRREHHTDEFEYDELILRRGQP
FHMVLFLSRPYESSDHVTLELCIGNNPEVGKGTHVIIPVGKGGSGGWKAQVTKSSGQNLN
LRVHTSPNAIIGKFQFTVRTRCKAGEFQLPFDPRNEIYILFNPWCPEDIVYVDHEDWRQE
YVLNESGRIYYGTEAQIGERTWNYGQFDHGVLDACLYILDRRGMPYGGRRDPVSVSRVIS
AMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSVEILLSYLRTGNSVPFGQCWVFAGVTTT
VLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDENMKPLEHLNHDSVWNFHVWNDCWMKRP
DLPSGFDGWQVVDATPQETSSGIFCCGPCSVQSIKNGLVYMKYDTPFIFAEVNSDKVYWQ
RQDDGSFKIVYVEEKAIGSLIITKAIGSNMREDVTHTYKHPEGSEAERKAVETAAAHGSK
PNVYATRDSTEDVAMQVEAQGTVMGQDLTVCVVLTNRGSSPRTVKLHLYLSVTFYTGVTG
SVFKESKKEVVLAPGASERVTMPVAYKEYRAQLVDQGAMLLNVSGHVKENGQVLAKQHTF
RLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGG
NETVTLRQTFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVAPAGGGGAFSDIRGSGRSRE
TIPMASRGGA
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgccaacaccttcatcagggggtcctcgctcggatntcggccgctggggtgga
aacccctggcggccccccaccaccccttctccagagccggaaccagagccagacagacgt
tctcgccgcgggggccgatccttctgggctcgctgctgcggctgctgctcttgcaggaac
tcccgccggcctggctcccggggcagcgctgtgaacgcagctggagatggcaccatccgg
gacggaatgctggtggtcactggcatggatctgctgagttcacgctcagaccagaaccgc
cgagagcaccacacagacgagttcgagtacgatgagctgattctccgccgtgggcagcct
ttccatatggtcctcttcctgtctcgtccctatgagtcctccgatcatgtcaccctggag
ctgtgcatcggaaacaatcccgaggtgggcaagggcacccacgtgatcatcccggtgggc
aaggggggcagtggaggctggaaggcccaggtgaccaagtccagcgggcagaatctgaac
ctgcgggtccacacctcccccaacgccatcatcggcaagtttcagttcactgtccgcaca
cgctgcaaagctggagagttccaactgccctttgacccccgcaacgagatctacatcctc
ttcaatccctggtgccccgaggacatcgtgtatgtggaccatgaggactggcggcaggag
tatgtgcttaatgagtctgggcgaatttactatgggacagaagcgcagattggcgagcgg
acctggaactacggccagtttgaccacggggtgctggacgcctgcctgtacatcctggac
cggcggggcatgccctatggaggccgcagggaccccgtcagtgtctcccgggtcatctct
gccatggtgaactccttggatgacaatggggtcctgattgggaactggtctggagattat
tcccgcggtaccaacccatcagcatgggtgggcagcgtggagatccttctcagctaccta
cgcaccggcaactctgtccccttcggccagtgctgggtcttcgccggtgtgaccaccaca
gtgctgcgctgcctgggcctggccacccgtactgtcaccaacttcaactccgcgcacgac
acagacacttccctcaccatggacatctactttgatgagaacatgaagcccctggagcac
ctgaaccatgattctgtctggaacttccacgtgtggaatgactgttggatgaagaggcca
gatctgccctcaggcttcgatgggtggcaggttgtggatgccacaccccaggagaccagc
agtggcatcttctgctgtgggccctgctctgtgcagtccatcaagaatggcttggtctac
atgaagtacgacacacccttcattttcgcagaggtaaacagtgacaaagtttactggcag
cgacaggatgacggcagcttcaagatcgtgtatgtggaggagaaagccatcggctcactc
atcattacaaaggctatcggctccaacatgcgagaagacgtcacgcacacctataagcac
ccagaaggctcagaagcagagcggaaggcagtggagaccgcagccgcccacggcagcaaa
cccaacgtgtacgccacgcgggactcgacggaggatgtggccatgcaggtggaggcgcag
ggcacagtgatggggcaggacctgacggtctgcgtggtgctgaccaaccgcggcagcagc
ccccgcaccgtgaagctgcacctctacctctctgtcaccttctacaccggcgtcacggga
tccgtcttcaaggagagcaagaaggaggtggtgctggcgccgggggcctcggagcgcgtg
accatgcccgtggcctacaaggaataccgggcccagctcgtagaccagggagccatgctg
ctcaacgtctcaggccacgtgaaggagaacgggcaggtgctggccaagcagcacaccttc
cgtctgcgtaccccagacctcagtctcacgttactgggagcagctgtggttggccaggag
tgcgaagtacagattgtcttcaagaacccgctgcctgtcaccctcaccaacgtcgtcttc
cggctcgagggctccgggttgcagaggcccaagatcctcaatgtcggggacattgggggc
aacgagacagtgaccctgcgccagacgtttgtgcctgtgagaccaggtccccgccagctc
attgccagcttggatagcccacagctctcccaggtgcacggggtcatccaggtggacgta
gccccagccggcggaggcggggccttctcagacattagaggcagcggtcgctcacgggag
accatccccatggcctctcgaggtggggcttag

DBGET integrated database retrieval system