KEGG   Ovis aries (sheep): 101114322
Entry
101114322         CDS       T03117                                 

Gene name
MMS19
Definition
(RefSeq) MMS19 nucleotide excision repair protein homolog isoform X2
  KO
K15075  DNA repair/transcription protein MET18/MMS19
Organism
oas  Ovis aries (sheep)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101114322 (MMS19)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     101114322 (MMS19)
SSDB
Motif
Pfam: MMS19_C MMS19_N HEAT_2 Dopey_N
Other DBs
NCBI-GeneID: 101114322
NCBI-ProteinID: XP_011958098
Ensembl: ENSOARG00000010436
LinkDB
Position
22
AA seq 1029 aa
MAAAAALEAVAPLGALWGLVQDFVMGQQEGPADQVAADVKSGSYTVLQVVEALGSSLENP
EPRTRARGIQLLSQVLLQCHSLLLEKEVVHLILFYENRLKDHHLVIPSVLQGLRALSLCV
ALPPGLAVSVLKAIFQEVHVQSLPQVDRHTVYSIITNFMRTREEELKGLGADFTFGFIQV
MDGEKDPRNLLVAFRIVYDLISRDYSLGPFVEELFEVTSCYFPIDFTPPPNDPHGIQRED
LILSLRAVLASTPRFAEFLLPLLIEKVDSEILSAKLDSLQTLNACCAVYGQKELKDFLPS
LWASIRREVFQTASERVEAEGLAALNSLTACLSRSVLRADAEDLLDSFLSNILQDCRHHL
CEPDMKLVWPSAKLLQAAAGASARACDHITSNVLPLLLEQFHKHSQSNQRRTILEMILGF
LKLQQKWSYEDKDERPLSGFKDQLCSLMFMALADPNTQLQLVGIRTLTVLGAQPDLLSSG
DLELAVGHLYRLSFLEEDSQSWVAALEASGSLATLYPVAFSSHLVPKLAEDLCSEESDLA
RGDGPTRCSQHPRCLQALSAVSTHPSIVKETLPLLLQHLCQMNRGSMTPGTSEVIAVCQS
LQQVAEKCQRDPESCWYFHQTAVPCLLALAVQASTPEKEHSVLKKVLLEDEVLATMASVI
ATATTHLSPDLAAQSVAHVVPLFLDGNISFLPENSFSGRFQPFQDGSSGQRRLVALLMAF
VCSLPRNVEIPQLNRLMRELLELSCCQSCPFSSTAAAKCFAGLLNKHPAGQELDEFLQLA
VDKVEAGLSSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTERLMGLLSDPELGPAAADGF
SLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVRGFHAAPQDVKPNYLKGLSHVLNR
LPKPVLLPELPTLLSLLLEALSCPDSVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLT
LSASPSMVVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARGE
WFLLGSPGS
NT seq 3090 nt   +upstreamnt  +downstreamnt
atggccgccgccgcggctctggaggcggtggcgcctctgggcgccctgtggggcctcgtg
caagacttcgtcatgggtcagcaggagggccccgctgaccaagtggctgcagatgtgaag
tctggaagctatacagtgttacaagtggtggaagcccttgggtcttctctagagaatcca
gaaccccgaactcgggcacgtggaatccagcttttgtcacaggtgctcctccagtgtcat
tccttgctcctggagaaggaagtggtccacctgatcctgttctatgagaaccggctgaag
gatcatcatctcgtgatcccgtctgtcctgcagggtttgagggcacttagcctgtgtgtg
gccctgcccccagggctggcagtctctgtgcttaaagccatcttccaggaggtccatgta
cagtccctgccgcaggtggaccgacacacagtctacagtatcatcaccaacttcatgcga
acccgggaagaagagctgaagggcctaggagctgatttcacctttggcttcatccaggtg
atggatggggaaaaggatccccgtaatcttctggtggccttccgcattgtctatgacctc
atctccagagactacagcctgggaccttttgtggaggagttgtttgaagtgacatcttgt
tacttccctattgattttactcctccacctaatgatccccatggcatccagagagaagat
ctcatcctgagtcttcgagctgtgctggcttctacaccacgctttgctgagttcctgctg
cccctgctgattgagaaagtggactccgagattctgagtgccaagctggattctctgcag
actctgaatgcttgctgtgccgtgtacggacagaaagaactaaaggacttccttcccagc
ctctgggcttctatccgcagagaggtgttccagacggcaagtgagcgggtagaggccgag
ggcctggcggccctcaactccctgactgcgtgtttgtctcgctctgtgctgagggccgat
gctgaggacctccttgactccttccttagcaacattctacaggactgcaggcaccatctg
tgtgaaccggacatgaaactggtgtggcctagcgccaaactgctgcaggcggctgcaggt
gcatctgcccgggcctgcgaccacatcaccagcaacgtgctgcctctgctgctggaacag
ttccacaagcacagccagagcaaccagcggaggacaatccttgaaatgatcctgggtttc
ctgaagctgcagcagaaatggagctatgaagacaaggatgaaagacctctgagtggcttc
aaggaccagctgtgctcactgatgttcatggccctggcagaccccaacacccagcttcag
cttgttggcattcgcacactcacagtgttgggtgctcagccagatctcctgtcttctggg
gatttggagctagcagtgggtcacctgtacagactgagcttcctggaggaggattcccag
agttgggtggcagcactggaggcatcaggaagcctggccactctctaccccgtggccttc
agcagccacctagtgcccaagcttgctgaggatctgtgttcagaggagtcagatttggct
agaggggatgggcccaccaggtgctcccaacatccacgctgtctgcaagccttatcagct
gtatccacacatcccagcatcgtcaaggagacgctgcctcttctgctgcagcatctgtgc
cagatgaacagagggagtatgactccaggaaccagtgaagttattgctgtctgtcagagc
ctccagcaggtggcagaaaaatgccagcgagaccccgagagctgctggtacttccatcag
acagctgtcccctgcctgcttgccttggctgtgcaggcttccacaccagagaaggagcac
tcagttctgaaaaaagtcctgttggaggatgaggtcttggccactatggcgtcggtcatt
gccactgccaccacccacttgagccctgacttagccgcccagagtgtcgcccacgtcgtg
cccctcttcttggacggcaacatctccttcctgcctgaaaacagcttctctggcagattc
cagccattccaggatggctcctcagggcagagacgactggtcgcactgcttatggccttt
gtctgctccctgcctcgaaacgtggaaatcccacagctgaaccgactcatgcgggagctt
ttagagctgagctgctgccaaagctgccccttctcctctacggcagccgccaagtgcttc
gcaggactcctgaacaagcaccctgcagggcaagagctggatgaatttctgcagctggct
gtggacaaagtggaggctgggctgagctctgggccctgtcgtagtcaggccttcacactg
cttctctgggtcacaaaggccttagtgcttagataccatcctctcagttcctgccttaca
gagcggctcatgggcctcctgagtgatccagaactaggcccggcagccgctgatggcttc
tctctgctcatgtccgactgcactgacgtgctaactcgtgctggtcatgctgaagtgcgg
atcatgttccgccagcggttcttcacggataacgtgcctgctttggtccggggcttccat
gctgctccgcaagatgtgaagccaaactacctgaagggtctgtctcatgtacttaacagg
ctaccaaagcctgtgctcttgccagagctgcctacgctgctctccctactgctggaggcc
ctgtcctgccctgactctgtggtgcagctctcaaccctcagctgccttcagcctcttcta
ctggaagcaccccaggtcatgagtcttcacgtcgacaccctcgtcaccaagttcctgacc
ctcagtgccagcccttccatggtggtccggatcgctgcactgcagtgcatgcatgctctc
actcgcctgcccacccccgtgttgctgccatacaaaccacaggtgatccgggccttagcc
aaacccctggatgacaagaagagactggtgcgcaaggaagcagtgtcagccaggggagaa
tggtttctgctggggagccctggcagctga

DBGET integrated database retrieval system