KEGG   Ovis aries (sheep): 101115280Help
Entry
101115280         CDS       T03117                                 

Gene name
SORD
Definition
(RefSeq) sorbitol dehydrogenase isoform X1
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
oas  Ovis aries (sheep)
Pathway
oas00040  Pentose and glucuronate interconversions
oas00051  Fructose and mannose metabolism
oas01100  Metabolic pathways
Module
oas_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101115280 (SORD)
   00051 Fructose and mannose metabolism
    101115280 (SORD)
Enzymes [BR:oas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     101115280 (SORD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 101115280
NCBI-ProteinID: XP_004010700
Ensembl: ENSOARG00000021059
LinkDB All DBs
Structure
PDB: 

Position
7
AA seq 356 aa AA seqDB search
MAAAKPENLSLVVHGPGDLRLENYPIPEPGPNEVLLKMHSVGICGSDVHYWQHGRIGDFV
VKKPMVLGHEASGTVVKVGSLVRHLQPGDRVAIEPGAPRETDEFCKIGRYNLSPTIFFCA
TPPDDGNLCRFYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGNKVLVCGA
GPIGLVNLLAAKAMGAAQVVVTDLSASRLSKAKEVGADFILQISNESPQEIAKKVEGLLG
SKPEVTIECTGVETSIQAGIYATHSGGTLVLVGLGSEMTSVPLVHAATREVDIKGVFRYC
NTWPMAISMLASKSVNVKPLVTHRFPLEKALEAFETSKKGLGLKVMIKCDPSDQNP
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccaagcccgagaacctctccctggtggtgcacggacccggagacttgcgc
ttggaaaactatcctatccctgaaccaggcccaaacgaggtgcttctgaagatgcattct
gttggaatttgtggctcagatgtccattactggcagcacggtcgaattggagattttgtt
gtgaaaaagccaatggtgctggggcatgaagcttcaggaacagttgtaaaagtgggatca
ttggtcaggcacctacaaccaggtgatcgtgttgccatcgagcctggtgctcctcgagaa
accgatgagttctgcaagattggccgatacaatctgtcacctaccatcttcttctgtgcc
acgccccccgatgatgggaacctctgccggttctacaagcacaatgctaacttctgctac
aagcttcctgacaatgtcacctttgaggaaggggccctgattgagccactgtctgtgggg
atccatgcctgccggcgagctggagtcaccctggggaacaaagtccttgtgtgtggagct
gggccaattggactggttaatttgcttgcagccaaggcaatgggtgcagctcaagtggtg
gtgactgatctgtcagcctctcggttgtctaaagccaaggaagtcggggctgatttcatc
ctccagatctccaatgagagccctcaggaaatagccaagaaagtggaaggcctgctgggc
agcaagccagaagtcacaattgagtgcacaggggtggagacctccatccaggccggcatc
tatgccactcattccggtgggaccctggtactggtggggctgggctctgagatgaccagt
gtgccccttgtgcacgcagccaccagggaggtggacattaagggcgtgtttcgatactgc
aatacatggccaatggcgatttcaatgcttgcatccaagtctgtgaatgtaaagcccttg
gtcacccatcggtttcctctggagaaagctctggaggcctttgaaacatccaaaaagggt
ttggggttgaaagtcatgatcaagtgtgaccccagcgaccagaatccatga

DBGET integrated database retrieval system