KEGG   Ovis aries (sheep): 101115418
Entry
101115418         CDS       T03117                                 

Gene name
ETV5
Definition
(RefSeq) ETS translocation variant 5 isoform X1
  KO
K15593  ets translocation variant 5
Organism
oas  Ovis aries (sheep)
Pathway
oas05202  Transcriptional misregulation in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101115418 (ETV5)
  09162 Cancer: specific types
   05215 Prostate cancer
    101115418 (ETV5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101115418 (ETV5)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    101115418 (ETV5)
SSDB
Motif
Pfam: ETS_PEA3_N Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 101115418
NCBI-ProteinID: XP_027813324
Ensembl: ENSOARG00000020548
UniProt: A0A6P7D5A8
LinkDB
Position
1
AA seq 511 aa
MDGFYDQQVPFMVPGKSRSEESRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAE
AQVPDDEQFVPDFQSDNLVLHAPPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNY
CAYDRKPPSGFKPLTPPTTPLSPTHQNSLFPPPQATLPTSAAHAPAAGPVPGVGPTPTPH
SLPEPGPQQQTFAVPRPPHQPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQSGVPGDN
RPNYHRQMSEPIVPAAPPPPQGFKQEYHDPLYEHGVPGMPGPPAHGFQSPMGIKQEPRDY
CVDSEVPNCQSYMRGGYFSGSHEGFSYEKDPRLYFDDTCVVPERLEAGKVKQEPTMYREG
PPYQRRGSLQLWQFLVTLLDDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNY
DKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEED
TLPLTHFEDNPAYLLDVDRCGSLPYAEGFAY
NT seq 1536 nt   +upstreamnt  +downstreamnt
atggatgggttttatgatcaacaagtcccttttatggtcccagggaaatctcggtcagag
gagagtagagggcggcctgtgattgacagaaagaggaagtttttggacacagatctggct
catgattctgaagagttgtttcaggatctcagtcaacttcaagaggcttggttagctgaa
gcacaagttcctgatgacgaacagtttgtcccagattttcagtctgataacttggtgctt
catgccccacctccaaccaagatcaaacgggagctgcacagcccctcctctgagctgtca
tcctgtagccacgagcaggctctcggtgctaattatggagaaaagtgcctctacaactat
tgtgcctatgataggaagcctccctctgggttcaagccattaacccctcctaccaccccc
ctgtctcccacccatcagaattccctatttcccccacctcaggcaactctgcccacctcg
gcggcacatgcccctgcagctggcccagtcccaggtgtgggccccacccccacccctcat
tcgcttccggaacctggaccacagcagcaaacctttgcggtcccccggccgccacatcag
cccttgcagatgccaaagatgatgcctgaaaaccagtatccatcagaacagagatttcag
agacagctgtctgaaccctgccaccccttccctcctcagtcaggagttcctggagataat
cgccctaattaccaccggcaaatgtcagaacctattgttcctgcagctcccccaccccct
cagggattcaaacaagaataccatgacccactctatgaacatggggtcccaggcatgcct
ggtcccccagcacatgggttccagtcaccaatgggaatcaagcaggagccccgggattac
tgcgttgattcagaagtgcctaactgccagtcctacatgagaggaggctacttctccggt
agccatgaaggtttttcatatgagaaggatccccggttgtactttgacgacacttgtgtc
gttcctgagagactggaagcaggcaaagtgaaacaagagcccaccatgtatcgggaaggg
cccccttaccagaggcgaggttcccttcagctgtggcagttcctggttacccttcttgac
gacccagccaacgcccacttcattgcctggacaggccgaggcatggaattcaagctgata
gaacccgaagaggttgctcggcgttggggcattcagaagaaccggccagccatgaactat
gacaagctcagccgatctctacgctattactatgaaaagggcatcatgcagaaggtggcc
ggggaacgatatgtctacaagttcgtttgcgaccctgatgcccttttctccatggccttc
cctgacaaccagcgtccgttcctgaaagcagagtctgagtgccacctcagcgaggaggac
accctgccactgacccactttgaggacaaccctgcttatcttctggatgtggaccgctgc
ggcagcctcccctatgccgaaggctttgcttactaa

DBGET integrated database retrieval system