KEGG   Ovis aries (sheep): 101115595
Entry
101115595         CDS       T03117                                 

Gene name
PMS2
Definition
(RefSeq) mismatch repair endonuclease PMS2 isoform X4
  KO
K10858  DNA mismatch repair protein PMS2
Organism
oas  Ovis aries (sheep)
Pathway
oas03430  Mismatch repair
oas03460  Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:oas00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    101115595 (PMS2)
   03460 Fanconi anemia pathway
    101115595 (PMS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:oas03400]
    101115595 (PMS2)
DNA repair and recombination proteins [BR:oas03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     101115595 (PMS2)
SSDB
Motif
Pfam: MutL_C DNA_mis_repair HATPase_c_3 HATPase_c MORN_2
Other DBs
NCBI-GeneID: 101115595
NCBI-ProteinID: XP_004021103
Ensembl: ENSOARG00000001384
UniProt: W5NTF5
LinkDB
Position
24
AA seq 864 aa
MERADGPSSELAKAIKPIDRKSVHQICSGQVVLGLSTAVKELVENSVDAGATSIDLRLKD
YGVELIEVSDNGCGVEEANFEGLTLKHHTSKIQEFADLTQVETFGFRGEALSSLCALSDV
TISTCHTSVKVGTRLVFDHNGKILQKTPYPRPRGTTVSVQQLFYTLPVRHKEFQRNIKKE
FTKMVQVLQAYCIISAGVRISCTNQVGQGKRQPVVCTSGSSSMKENIGLVFGQKQLQSLI
PFVQLPPSDSICEEYGLSCSQALHNLFCISGFISHCAHGVGRSSTDRQFFFINRRPCDPA
KVSRLVNEVYHMYNRHQYPFVVLNISVDSECVDINVTPDKRQILLQEEKLLLAVLKTSLI
GMFESDVNKLQVSQQPLLDVEGHLIKRPLAEMEKPEPEKDNPAPLRTPGEEKRVVTISRL
REAFSLRHSTENKSRGPKATDPRRVSPRQKSSAQFPRALGPPCSRKRISEPGEEGRTSAQ
GPHDLMGRVETEEDSGHGSASAGSEEASSTPETSGHPSTDQVASTPEDRFSQENVESREK
LPETDHHLSGPKCHVNQEESGSASGVLPQPTKLSSPNAKRFKNEGTPLNPDVLSESVKTQ
SAAASEVDVAVKINKKIVPLDFSMSSLAKRIKQLCQQEQQQESQQNYRKFRAKICPGENQ
AAEDELRKEISKTMFAEMEIIGQFNLGFIITKLNADIFIVDQHATDEKYNFEMLQQHTVL
QGQRLIAPQTLSLTAVNEAILIENLEIFRKNGFDFVIDEHAPVTERAKLISLPTSKNWTF
GPQDIDELLFMLSDSPGVMCRPSRVRQMFASRACRKSVMIGTPLNTSEMKKLITHMGEMD
HPWNCPHGRPTMRHIANLDVISQS
NT seq 2595 nt   +upstreamnt  +downstreamnt
atggagcgagctgacgggccgagttcagaacttgctaaggccatcaaacctatcgatcgg
aagtcagtccatcagatttgttctgggcaagtggtacttggtctaagcactgctgtgaag
gagttggtagaaaatagtgtggatgccggtgcaactagtattgatctcaggcttaaagac
tatggagtggagctcatcgaagtttcagacaacggatgtggggtagaagaagcaaatttt
gaaggcttaactctgaaacatcacacttcgaagattcaggagtttgctgacctcactcag
gttgaaacttttggctttcgaggggaagctctgagctcactctgtgcactgagcgacgtg
actatttctacctgccacacgtctgtgaaggttggaactcgattggtgtttgatcacaat
ggaaaaatcctccagaaaaccccctacccacgacccagggggacgacggtcagcgtgcag
cagctattttatacgcttcctgtgcgccataaggagtttcaaaggaatattaagaaggag
ttcaccaagatggttcaggtgttacaggcatactgcatcatttcagcaggcgtccgtata
agttgcaccaatcaggttgggcagggcaagcggcagcctgtggtgtgcaccagcggaagc
tccagcatgaaggaaaacatcggattggtgtttgggcagaagcagttgcaaagcctcatc
ccctttgtgcagctgccccctagtgactccatctgcgaagaatatgggctgagctgttcc
caggctctgcataacctgttttgtatctcaggttttatttcgcactgtgctcatggcgtg
ggaagaagttcaacggacagacagtttttctttatcaatcggcggccttgtgacccagca
aaggtttccagacttgtgaatgaggtctatcacatgtataatcgacatcagtacccattt
gttgttcttaatatttctgttgattctgaatgtgtcgacattaacgttactccagataaa
aggcaaattttactgcaagaggagaagcttttgttggcagttttaaagacatctttgata
ggaatgtttgagagtgatgttaacaagctccaggtcagccagcagccgctgctggatgtg
gaaggtcacttaataaagaggcctttggcagagatggagaagcctgagccagaaaaggat
aatcctgccccattaaggactcctggagaagagaaaagagtagtgaccatttccaggctg
agagaagccttttcccttcgtcactcaactgagaacaagtcccggggtccgaaggccacc
gatccgaggcgggtttctccgagacagaaaagcagtgcccagtttcctagagctttgggg
cccccctgctcccggaagcgcatctctgaacctggggaggaagggaggacttctgctcag
gggccccatgacttgatgggcagagtggagacggaggaggactcggggcatggcagcgca
tctgccggctccgaggaggcatccagcacccccgagacgagcggccaccccagcactgac
caggtggcaagcacccccgaagacagattttcccaagaaaatgtggagtctcgggaaaag
ttacctgaaactgaccatcatctttcaggcccaaagtgccatgtaaaccaagaagaaagc
ggctctgcatctggagtcttgccgcagcccacgaagctctcatccccaaacgcaaagcgt
tttaaaaacgaagggactcctttaaatcccgatgtcctttcagagtcggtgaaaacccag
agtgcggcagcgtccgaggtggatgtagctgtgaaaattaacaagaaaatagtgcccctt
gatttttccatgagttctttagccaaacgaataaagcagttgtgtcagcaagaacagcaa
caagaaagtcagcagaattataggaagtttcgggcaaagatttgccctggagaaaatcaa
gcagcagaagacgaactaagaaaagagatcagcaaaacaatgtttgcagaaatggaaatc
attggccagtttaacttggggttcatcatcaccaagctgaatgcagacatcttcatagtg
gaccagcatgccacggacgagaaatacaacttcgagatgcttcagcagcacactgttctc
cagggtcaaaggcttatagcacctcagactctcagcctaacggctgtcaatgaagcaatt
ctaatagaaaatctggaaatattcaggaagaatggctttgactttgttattgacgaacac
gcaccggtcactgaaagagccaagttgatttccttgccaaccagtaagaactggaccttt
ggaccccaggacatagatgagctgctcttcatgctgagcgacagccccggggtcatgtgc
cggccctcccgcgtccggcagatgttcgcctccagagcctgtcgcaagtctgtgatgatt
ggaacccctcttaacacaagtgagatgaagaagctcatcacacacatgggggagatggac
catccctggaactgtccccacggaaggcccaccatgagacacattgccaacctggatgtc
atttctcagagctga

DBGET integrated database retrieval system