KEGG   Ovis aries (sheep): 101115891
Entry
101115891         CDS       T03117                                 

Gene name
ZEB1
Definition
(RefSeq) zinc finger E-box-binding homeobox 1 isoform X1
  KO
K09299  zinc finger homeobox protein 1
Organism
oas  Ovis aries (sheep)
Pathway
oas05202  Transcriptional misregulation in cancer
oas05206  MicroRNAs in cancer
oas05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:oas00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101115891 (ZEB1)
   05206 MicroRNAs in cancer
    101115891 (ZEB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    101115891 (ZEB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:oas03000]
    101115891 (ZEB1)
Transcription factors [BR:oas03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, AbdB
    101115891 (ZEB1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-met zf-Di19 zf-C2H2_jaz Homeodomain zf-C2H2_6 zf-C2HE zf-C2H2_2 zinc_ribbon_15
Other DBs
NCBI-GeneID: 101115891
NCBI-ProteinID: XP_014955113
Ensembl: ENSOARG00000013971
UniProt: A0A6P3YPN3
LinkDB
Position
13
AA seq 1127 aa
MADGPRCKRRKQANPRRNNVTNYNTVVETNSDSDDEDKLHIVEEESITDAADCEGGMPDD
DLPSDQTVLPGSSAREGSAKSCWEDDAGKEGQEILGPEARADEVGCAVKDDECDSEAENE
QNHDPNVEELLQQEDTAVIYPEAPEDDQRQGTPEASGHDENGTPDAFSQLLTCPYCDRGY
KRFTSLKEHIKYRHEKNEDNFSCSLCSYTFAYRTQLERHMTSHKSGREQRHVTQSGGNRK
FKCTECGKAFKYKHHLKEHLRIHSGEKPYECPNCKKRFSHSGSYSSHISSKKCISLMPVN
GRPRTGLKTSQCPSPSLSASPGSPTRPQMRQKTENKPLQEQLPVNQIKTEPVDYEFKPIV
VASGINCSAPLQNGVFSGGGPLQATSSPQGVVQAVVLPTVGLVSPISINLSDIQNVLKVA
VDGNVIRQVLENNQASLASKEQETISASSIQQGGHSVISAISLPLVDQDGTTKIIINYSL
EQPSQLQVVPQNLKKETPVPTNNCKSEKLPEDLTVKSEKDKSFEGGGNDSTCLLCDDCPG
DINALPELKHYDLKQPAQPPRPPTPEAAKPEASAPSGSGDGSLSPSQPPLKNLLSLLKAY
YALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKANTPAKSD
GQPQAADADETQDSTGNRQSPLKRASSPVLPGGSAINGSGSSASSPSPLNLSSSRSAQGY
SYPTEGAQEEPQVEPLDLSLPKQQGELLERPTITSVYQNSVYSVQEEPLNLSCAKKEPQK
DSCVTDSEPVVNVIPPSANPINIAIPTVTAQLPTIVAIADQNSVPCLRALAANKQTILIP
QVAYTYSTAVSPAVQETPLKVIQPNGNQDERQDTSSEGVSNVEDQNDSDSTPPKKKMRKT
ENGMYACDLCDKIFQKSSSLLRHKYEHTGKRPHECGICKKAFKHKHHLIEHMRLHSGEKP
YQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEEREPPEPGAAGPGVPPEQHAGQGDSDER
ESSTREEDEDSEKEEEEEEEERELEELEEEKGSGAAQGAEEVEEEVEDGEEEMDDEEDEE
EEAEEEGERAETEGVGQGAGAGSQAHSLEHKVSEGSEQVSEEKTNEA
NT seq 3384 nt   +upstreamnt  +downstreamnt
atggcggatggccccaggtgtaagcgcagaaagcaggcgaacccgcggcgcaataacgtt
acaaattataatactgtggtagaaacaaactcagattcagacgatgaagacaaactccac
attgtggaagaagaaagcattacagatgcagccgactgtgaaggcggcatgccagacgat
gacctgccctcagaccagacagtgttgcccgggagcagcgcgagagaagggagcgcaaag
agctgctgggaggatgatgcaggaaaggaaggacaagaaatcctggggccggaagctcgg
gcagatgaagtgggatgtgcagtaaaagatgatgaatgcgactcagaggcagagaatgag
caaaaccatgatcctaacgttgaagagctcctgcaacaagaagacactgcagtcatctac
cccgaggcacccgaggacgaccagaggcagggcacgccggaggccagcgggcatgacgaa
aacggaacaccagatgcattttcccagttgctcacctgtccgtattgtgacagaggatat
aaacgctttacctctctgaaagaacacattaagtatcgccacgagaagaatgaagacaac
ttcagctgctccctgtgcagttacacgtttgcatacagaacccagcttgagcgccacatg
acctcccacaaatcaggacgagagcagagacatgtgacgcagtctgggggtaatcgtaaa
ttcaagtgcactgaatgtggaaaagctttcaaatacaaacaccatctaaaagagcactta
agaatccacagtggagagaagccatatgaatgcccaaactgcaagaaacgtttttcccat
tctggttcctacagctcacacatcagcagtaagaaatgtatcagcctgatgcctgtgaac
gggcggccgagaacagggctcaagacctcgcagtgcccctcaccctcgctctcggcctct
ccaggcagccccacgcggccacagatgcggcagaagacagagaacaagcccctgcaagag
caacttcccgtaaaccagatcaaaaccgaacctgtggattacgagttcaaacccatagtg
gttgcttcaggaatcaactgctcagcccctctacagaacggggttttcagtggtggtggc
cccttacaggcaaccagttctcctcagggtgtggtgcaggccgtcgttctgccaacggtg
ggtttggtgtcccccatcagcatcaatttaagcgatattcagaatgtacttaaagtggcg
gtagatggtaatgtcatcaggcaagttttggagaataatcaagccagtcttgcatccaaa
gaacaagaaacaatcagtgcttcatccatccagcaaggcggccattctgttatttcagcc
atcagtcttcctctggttgatcaagatggaacaaccaaaatcatcattaactacagtctt
gaacaacctagccaacttcaagttgttcctcagaatttaaaaaaagaaaccccagtcccc
accaacaattgcaaaagtgaaaagttaccagaagatcttactgtcaagtctgagaaggac
aaaagctttgaagggggagggaacgacagcacttgcctcctgtgtgacgactgtcccggg
gacatcaatgcacttccggagctgaagcactatgacctgaagcagcccgcccagccccct
cggccccccaccccagaagctgcgaagcccgaggcctccgctccatcggggtccggagat
ggcagtttgtctcccagtcagccacctttaaagaacctcttgtctcttctgaaagcatat
tatgctttgaacgcacagccaagtgcagaagagctctcaaaaattgccgattccgtgaac
ctaccactggatgtagtgaaaaagtggtttgaaaagatgcaagcgggacagatctcagtg
cagtcttctgaaccatcttccccggaaccaggcaaagccaacacccctgccaagagcgac
ggtcagcctcaggctgcagatgcagatgaaacccaggacagcacagggaaccgccagagc
cctctgaagagagctagctcccccgtcttaccagggggctcggccatcaatggttccgga
agcagcgcctcctccccttctcccctgaacctctcttcctccagaagcgcacagggttac
tcgtacccgacagaaggggcacaggaagagccgcaggtcgaacctcttgatctttcacta
ccaaagcagcagggcgagttattggaaaggccaactatcactagtgtttaccagaacagt
gtttattctgtccaggaagaacccttgaacttgtcttgtgcaaaaaaggagccacaaaag
gacagttgtgttacagactcagaaccagttgtaaatgtaatcccaccaagtgccaacccc
ataaatattgctatacctaccgtcactgcccagttacccacgatcgtggccatcgctgac
cagaacagcgttccgtgcttgcgagcactggctgccaacaagcagaccatcctgatcccc
caggtcgcctacacatactcgactgcagtcagcccggcggtccaggaaacacccttgaag
gtgatccagcccaatggaaatcaggatgaaaggcaagacactagctcagaaggagtatcc
aacgtagaggatcagaatgactccgattccacgccccccaaaaagaaaatgcggaagaca
gaaaacggaatgtatgcttgtgatttgtgtgataagatattccaaaagagtagctcactg
ttgagacataaatacgaacacacaggtaaaagaccccacgagtgtggcatctgcaaaaag
gcgtttaaacacaagcaccacctgatcgagcacatgcgcctgcactccggggagaagccc
taccagtgcgacaagtgcgggaagcgcttctcccactcgggctcctactcccagcacatg
aaccaccgctactcctactgcaagagggaggccgaggagcgggagccccccgagccgggg
gccgcaggcccaggggtcccgcccgagcagcacgcggggcagggcgactcggacgagagg
gagagctcaacgcgggaggaggatgaggacagcgaaaaggaggaggaagaggaggaggag
gagcgggagctggaggagctggaggaggagaagggaagtggagcggcgcaaggggcggag
gaggtggaggaggaggtggaggacggggaggaggagatggacgacgaggaggacgaggag
gaggaggcggaggaggagggggagagagcagaaacggaaggtgtggggcagggggcgggg
gctggaagccaagcccatagcttagaacataaagtcagtgagggcagcgagcaggtgtct
gaagagaaaacaaatgaagcctaa

DBGET integrated database retrieval system