KEGG   Ovis aries (sheep): 101116273Help
Entry
101116273         CDS       T03117                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like isoform X2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
oas  Ovis aries (sheep)
Pathway
oas00480  Glutathione metabolism
oas00980  Metabolism of xenobiotics by cytochrome P450
oas00982  Drug metabolism - cytochrome P450
oas00983  Drug metabolism - other enzymes
oas01524  Platinum drug resistance
oas05200  Pathways in cancer
oas05204  Chemical carcinogenesis
oas05225  Hepatocellular carcinoma
oas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101116273
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101116273
   00982 Drug metabolism - cytochrome P450
    101116273
   00983 Drug metabolism - other enzymes
    101116273
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    101116273
   05204 Chemical carcinogenesis
    101116273
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    101116273
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101116273
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    101116273
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:oas02000]
    101116273
Enzymes [BR:oas01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101116273
Transporters [BR:oas02000]
 Other Transporters
  Pores ion channels [TC:1]
   101116273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_3 GST_C_2 Glutaredoxin Corona_S2 DUF2207 GST_C_5
Motif
Other DBs
NCBI-GeneID: 101116273
NCBI-ProteinID: XP_011958282
Ensembl: ENSOARG00000007446
UniProt: W5PC25
LinkDB All DBs
Position
22
AA seq 241 aa AA seqDB search
MSGGTVRSLGKGSAPPGPVPEGLIRVYSMRFCPYAKRTLLVLRAKGIRHEVININLKNKP
EWFFKKNPLGLVPVLETSLGQLVYESAITCEYLDEAYPEKKLLPGDPYEKACQKMVFESF
SKVPSLMVSFLRKQNKEDCSDLKEELHKEFSKLEEILTNKKTTFFGGNSLSMIDYLIWPW
FEWLEALELNEYVDHTPNLKLWMASMKNDPIVSSLPTDVKTLRGFFNLYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggcggaacggtcaggagcctggggaagggaagcgcgcccccggggcccgtcccc
gagggcctgatccgtgtctacagcatgaggttctgtccttacgccaagaggacgctcctg
gtcctgagggccaagggaatccggcatgaagtcatcaacatcaacctgaaaaataagcct
gagtggtttttcaagaagaatcccttaggcctagtgccggttctggaaaccagtctgggt
cagttggtctatgaatctgccatcacttgtgagtacctggatgaagcatatccagagaag
aagctgttgccaggcgacccctatgagaaggcttgccaaaagatggtctttgagtccttt
tctaaggtaccatctttgatggtaagctttcttaggaagcaaaataaggaagattgctct
gacctaaaagaagaactgcataaagaattcagcaagctggaggagattctgactaataag
aagacaaccttctttggtggcaattctctttctatgattgattacctcatctggccctgg
tttgaatggctagaagccttggagttaaatgagtatgtagaccatactccaaatctaaag
ctctggatggcatccatgaagaatgatcccatagtatcatctctccccaccgatgtgaag
acccttcgaggtttcttcaacctctacttgcagaacagccctgaggcctgtgactatggt
ctctga

DBGET integrated database retrieval system