KEGG   Ovis aries (sheep): 101116562
Entry
101116562         CDS       T03117                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
oas  Ovis aries (sheep)
Pathway
oas04010  MAPK signaling pathway
oas04020  Calcium signaling pathway
oas04022  cGMP-PKG signaling pathway
oas04024  cAMP signaling pathway
oas04260  Cardiac muscle contraction
oas04261  Adrenergic signaling in cardiomyocytes
oas04270  Vascular smooth muscle contraction
oas04713  Circadian entrainment
oas04720  Long-term potentiation
oas04723  Retrograde endocannabinoid signaling
oas04724  Glutamatergic synapse
oas04725  Cholinergic synapse
oas04726  Serotonergic synapse
oas04727  GABAergic synapse
oas04728  Dopaminergic synapse
oas04742  Taste transduction
oas04911  Insulin secretion
oas04912  GnRH signaling pathway
oas04921  Oxytocin signaling pathway
oas04924  Renin secretion
oas04925  Aldosterone synthesis and secretion
oas04927  Cortisol synthesis and secretion
oas04929  GnRH secretion
oas04930  Type II diabetes mellitus
oas04934  Cushing syndrome
oas04935  Growth hormone synthesis, secretion and action
oas05010  Alzheimer disease
oas05020  Prion disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05031  Amphetamine addiction
oas05410  Hypertrophic cardiomyopathy
oas05412  Arrhythmogenic right ventricular cardiomyopathy
oas05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101116562 (CACNA1C)
   04020 Calcium signaling pathway
    101116562 (CACNA1C)
   04024 cAMP signaling pathway
    101116562 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    101116562 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101116562 (CACNA1C)
   04929 GnRH secretion
    101116562 (CACNA1C)
   04912 GnRH signaling pathway
    101116562 (CACNA1C)
   04921 Oxytocin signaling pathway
    101116562 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    101116562 (CACNA1C)
   04924 Renin secretion
    101116562 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    101116562 (CACNA1C)
   04927 Cortisol synthesis and secretion
    101116562 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101116562 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101116562 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101116562 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    101116562 (CACNA1C)
   04727 GABAergic synapse
    101116562 (CACNA1C)
   04725 Cholinergic synapse
    101116562 (CACNA1C)
   04728 Dopaminergic synapse
    101116562 (CACNA1C)
   04726 Serotonergic synapse
    101116562 (CACNA1C)
   04720 Long-term potentiation
    101116562 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    101116562 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    101116562 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101116562 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101116562 (CACNA1C)
   05020 Prion disease
    101116562 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    101116562 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    101116562 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101116562 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101116562 (CACNA1C)
   05414 Dilated cardiomyopathy
    101116562 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101116562 (CACNA1C)
   04934 Cushing syndrome
    101116562 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:oas04040]
    101116562 (CACNA1C)
Ion channels [BR:oas04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101116562 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 101116562
NCBI-ProteinID: XP_027823848
Ensembl: ENSOARG00000013089
LinkDB
Position
3
AA seq 2138 aa
MVNENTRMYIPEENHQGPSYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGLDEEKPRNMSMPTSETESVNTENVA
GGDIEGESCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSSIFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEMVEKPAVEETKEEKIELKSITADGESPPATKINMDDLQPNENEDKSSYPNQ
ETAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNRFRLQCHRIVNDS
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMVLKLIAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEEN
SRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQ
VFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGNS
TEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDLGPEIRRAISGDLTAEEELD
KAMKEAVSAASEDDIFRRAGGLFGNHVGYYPSDGRGAFPQTFTTQRPLHISKAGNSQGDT
ESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRCPRPAVHSGAVSTLEARGPPLSP
AIRVQEASWRHSSQRCPSRDSPIAMLCQEEAPGDETCAMRVDEDAEHSSEPSLVSTERLS
YQDDENRQLTPPEEDRRDVRLSPKRGFLRSASLGRRASFHLECLKRQKNPGGDVSQKTVL
PLHLVHHQALAVAGLSPLLQRSHPPGTLPPPRLTPPATPGPAWPLRPVPTLRLEGAESSD
KLTSSFPSIHCDPHVREPTPCGVVGTPRRARPVSLTVPSPAGPQGRPFHGSASSLVEAVL
ISEGLGQFAQDPRFLEATTQELADACDMTIEEMESAADDILSGGAGQSPNGTLLPCANCR
DPGPDRAGGVEDAAWAPSAEPRQGAEEPRDSRAFASGL
NT seq 6417 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacattccggaggagaaccaccaaggtcccagctat
gggagcccgcgcccggctcacgccaacatgaatgccaacgcggccgcggggctggcgcca
gagcacatccccacgccgggggccgccctgtcctggcaggccgccatcgacgcggcccgg
caggccaagctgatgggcagtgctggcaacgcaaccatctccacggtcagctccacgcag
cggaagcggcagcagtacgggaagcccaagaagcagggcagcacgacggccacccgcccg
ccccgcgccctgctctgcctgaccctgaagaaccccatccggagggcctgcatcagcatc
gtcgagtggaagccatttgaaatcattattttactgactatttttgccaattgtgtggcc
ttagcgatctatattcccttcccagaggacgactccaacgccacgaattccaacctggag
cgggtggagtatctctttctcatcatttttactgtggaagcatttttaaaagtcatagcc
tacggactcctctttcaccccaacgcttacctccgcaatggctggaacttactagacttt
atcatcgtggttgtcgggcttttcagcgcgatcttagagcaagcgaccaaagccgatggg
gccaatgccctgggagggaagggtgctggattcgacgtgaaggccctgagggcattccgt
gtgctgcggcccctgcggttggtgtctggggtcccgagtctccaggtggtcctgaattcc
atcatcaaggccatggtgcccctgctgcacatcgccctgctcgtgcttttcgtcatcatc
atctacgccatcatcggcctggagctgttcatgggcaagatgcataagacctgctacaac
caggagggcattgccgatgtcccagcagaagacgacccctcgccctgtgccctggagacg
ggccacgggcggcaatgccagaacggcacagtgtgcaaaccaggctgggacgggcccaag
cacggcatcaccaatttcgacaacttcgccttcgccatgctgactgtgttccagtgcatc
accatggagggctggaccgacgtcctctactgggtcaatgatgccgtgggaagggactgg
ccctggatctattttgtcacattaatcatcataggttcattctttgttcttaacttggtt
ctcggtgtccttagcggagagttctccaaagagcgagagaaggccaaggcccggggcgac
ttccagaagctgcgagagaagcagcagctggaggaggacctgaagggctacctggactgg
atcacgcaggctgaggacatcgaccctgagaatgaggacgagggcctggacgaagagaaa
ccccgaaacatgagcatgcccaccagtgagaccgagtctgtcaacaccgaaaacgtggct
ggaggggacatcgagggagagagctgcggggccaggctggcccaccggatctccaagtcg
aagttcagccgctactggcgccggtggaatcggttctgcaggaggaagtgccgcgcggcc
gtgaagtccagcatcttctactggctggtcattttcctggttttcctcaacacgctcacc
atcgcctccgagcactacaaccagccccactggctcacggaagtccaagacacggccaac
aaggcgctgctggccctgttcacggcggagatgctgctcaagatgtacagcctgggcctg
caggcctacttcgtgtcgctcttcaaccgcttcgactgcttcatcgtgtgcggcggcatc
ctggagaccatcctggtggagaccaagatcatgtcgcccttgggcatctccgtgctgcgc
tgcgtgcgcctcctgcggatatttaagatcacaaggtactggaactccctgagcaacctg
gtggcgtccctgctgaactcagtgcgctccattgcctcgctgctgctgctgcttttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggggggaagttcaactttgat
gagatgcagacccggaggagcaccttcgacaacttcccacagtccctcctcaccgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aattatatcctactgaacgtgttcttggccattgccgtggacaacctggctgacgccgag
agcctcacgtctgcccagaaggaggaggaagaggagaaggagaggaagaagctagccagg
accgccagcccagagaagaagcaagagatggtagagaagccggctgtggaagagaccaag
gaggagaaaatcgagttgaaatccatcacggcagatggagagtccccacccgccaccaag
atcaacatggatgatctccagcccaatgagaatgaggacaagagttcctaccccaaccag
gaaactgcaggagaagaggacgaggaggagcccgagatgcccgtgggcccccgcccacgc
cccctctctgagctgcacctgaaggagaaggcagtgcccatgccggaagccagcgccttc
ttcatcttcagccccagcaacaggttccgcctccagtgccatcgcatcgtcaatgactcc
atcttcaccaacctgatcctcttcttcatcctgctcagcagcatctccctggccgccgag
gaccccgtgcagcacacctccttcaggaaccacattctgttttattttgacattgttttc
actaccattttcaccattgagattgccctgaagatgacggcctacggggccttcctgcac
aagggctccttctgccgcaactacttcaacatcctggacctgctggtggtcagtgtgtcc
ctcatctccttcggcatccagtccagtgccatcaacgtggtgaagatcctgcgagtcctg
agggtgctccggccactgcgggccatcaacagggccaaggggctgaagcacgtcgtgcag
tgcgttttcgtggccatccgcaccatcgggaacattgtgattgtcaccacgctgctccag
ttcatgttcgcctgcattggggtccagctcttcaagggaaagctctacacctgttcggac
agttccaaacagacagaggctgaatgcaaggggaactacatcacatacaaggatggggag
gtggaccaccccatcatccagccccgcagctgggagaacagcaagtttgattttgacaat
gtcctggccgccatgatggccctgttcaccgtctccaccttcgagggatggccagagttg
ctgtaccgctccatcgactctcacacggaggacaagggtcccatatacaactaccgcgtg
gagatctccgtcttcttcatcatctacatcatcatcattgccttcttcatgatgaacatc
ttcgtgggtttcgtcatcgtcaccttccaggagcagggggagcaagagtacaagaactgc
gagctggacaagaaccagcggcagtgtgtggagtatgccctcaaggcccggcccctgcgg
aggtacatcccgaaaaaccagcaccagtacaaggtgtggtacgtggtcaactccacctac
ttcgagtacctgatgttcgttctcattctgctcaacaccatctgcctggccatgcagcac
tacggtcagagctgtctgttcaaaatcgccatgaacatcctcaacatgctcttcaccggc
ctcttcacagtggagatggtcctgaagctcatcgccttcaagcccaagcactatttctgt
gatgcatggaacacatttgacgccttgattgttgtgggtagcattgttgatatagccatc
accgaggtaaacccagctgaacatacgcaatgctctccctttatgaacgcggaggagaac
tctcgcatctccatcaccttcttccgcctcttccgggtcatgcgtctggtcaagctgctg
agccgtggggagggcatccggacactgctgtggaccttcatcaagtccttccaggcccta
ccctatgtggccctcctgatcgtgatgctgtttttcatctacgccgtgatcgggatgcag
gtgtttgggaaaatcgccctgaatgacacaacagagatcaacaggaacaacaacttccag
accttcccccaggccgtgctgctcctcttcaggtgtgccactggggaggcctggcaggac
atcatgctggcctgcatgcctggcaagaagtgcgcccccgagtcagagccgggcaacagc
acggagggggagacgccctgtggcagcagcttcgccgtcttctacttcatcagcttctac
atgctctgcgccttcctgatcatcaacctcttcgtagccgtcatcatggacaactttgac
tacctgacgagggactggtccatcctgggtccccaccacctggacgaatttaagagaatt
tgggcagagtatgaccctgaagccaagggacgcatcaagcacctggatgtggtgaccctg
ctccggcggattcagccccccctgggttttgggaagctgtgccctcaccgtgtggcttgc
aaacggctggtctccatgaacatgcccctgaacagcgacgggaccgtcatgttcaacgcc
acgctgtttgccctggtccggacagccctgaggatcaagacggaagggaacctggaacag
gccaatgaggagctgcgggccatcatcaagaaaatctggaaacggactagcatgaaactg
ctggaccaagtggtgccgcctgcaggagatgacgaggtcacagtgggcaagttttacgct
actttcctgatccaagagtatttccggaagttcaagaagcgcaaagagcaaggcctggtg
ggcaagccctcccagaggaatgccctgtccctgcaggctggcctgcgcaccctgcacgac
ctggggcctgagatccgccgggctatctctggggacctgaccgccgaggaggagctggac
aaggccatgaaggaggctgtgtctgcagcctcagaagatgacatcttcaggagggccggg
ggcctgttcggcaaccacgtgggctactaccccagtgatggccggggcgccttcccccag
accttcaccacccagcgccccctgcacataagcaaggcaggcaacagccagggggacact
gagtccccttcccacgagaagctggtagactccaccttcacccccagcagctactcatcc
acaggctccaacgccaacatcaacaatgccaacaacaccgccctgggccgctgcccccgc
cccgctgtccactctggtgctgtcagcaccttggaggcccgcgggccccccttgtcccct
gccatccgggtgcaggaggcctcatggaggcacagctcccagaggtgcccctcccgggac
agcccaatagccatgctgtgtcaggaagaggcccctggggacgagacctgtgccatgcgc
gtggacgaggacgcagagcacagcagcgagcccagcctggtctccacggagaggctctcc
taccaggatgacgagaatcggcagctgactccccccgaggaagacaggagggacgtccgt
ctgtccccaaagaggggcttcctgcgctccgcctccctaggtcgaagggcctccttccac
cttgaatgtctgaagcgacagaagaatcccgggggagacgtctctcagaagacagtcctg
cctttgcacctggttcaccatcaggcgctggcagtggcgggcctgagccccctcctgcag
agaagccatccccccgggaccctccccccaccacgcctcacaccccccgccacacctggc
ccagcctggcctctgcggcctgtgcccaccctgcggctggagggggccgagtccagcgac
aagctcaccagcagcttcccatccatccactgcgacccccacgtcagggagcccacgccc
tgtggggtcgtcggcacccccaggagggcccggcccgtgtcactcactgtgcccagcccg
gcagggccccagggccggccgttccacggcagtgccagcagcctggtagaggcggtcttg
atctcggaaggattggggcagtttgctcaggaccccaggttcctcgaggccaccacgcag
gagctggccgacgcctgcgacatgaccatcgaggagatggagagtgcagccgacgacatc
ctcagtgggggcgccgggcagagccccaatggcaccctgctcccgtgtgcaaactgcagg
gacccggggccggaccgagcggggggcgtggaggacgcagcctgggcgcccagcgccgag
ccccgccagggcgcagaggagccccgggacagcagggccttcgccagcggcctgtag

DBGET integrated database retrieval system